atomi shuri




FC2MARASDABMVSDNNPJJULHODVHDKAIPXROYDKSBJHZGDNACRCAWDSQTESSISMILKSTARSDASDSANAVSA

2020-09-12
180 min

[KAM-077]An Amateur NTR Posting This Bastard Fucked His Best Friend's Girlfriend! Peeping! Creampie Sex! Fuck Her And Put It Online In A Video Posting!

  • censoredcreampieamateurKAMkarmamanji groupKAM-077KAM077kam00077
    • 2020-09-21
    132 min

    [DBER-081]The Lusty Beast Hunting Club - An Alluring Beautiful Girl Cums In Hell - Cruel Hardcore Ver. Part 5: A Pure And Clean Angel Roars With Teary-Eyed Orgasmic Pleasure During A Shameful Breaking In Training Session Sara Kagami

  • kagami sara censoredschoolgirlbdsmDBERbabyentertainmentkikubonred babeDBER-081DBER081dber00081
    • 2020-09-25
    31 min

    [BTH-071]I Can't Tell Anyone. Kissing An Older Man. Kurumi Tachibana

  • tachibana walnut censoredblowjobsingle workBTHchobitchchovicBTH-071BTH071h-1435bth00071
    • 2020-09-25
    145 min

    [BANK-015]Meet A Normal-Looking, Adorable Housewife Who Looks Like The Kind Of Lady Who Lives In The Neighborhood Of The Creampie Outdoor Hot Spring Resort! She Looks Like A Plain Jane, But This Beautiful And Innocent Lady With A Slender Body Has Hug

  • censoredcreampieBANKpussy banktake chanBANK-015BANK015h-1495bank00015
    • 2020-09-27
    243 min

    [GAV-052]Gal Pussy Licking Legend PART. 2

  • censoredcreampieamateurGAVprestigetoy girlGAV-052GAV052gav00052
    • 2020-10-01
    125 min

    [HDKA-218]A Naked Housewife Living In Suginami Ward - Ayaka Makimura (40)

  • ayaka makimura censoredcreampiebig titsHDKAplanet plusdirector orafu shukoHDKA-218HDKA218h-237hdka00218
    • 2020-10-04
    61 min

    413INST-058 G-Cup God Milk Dollar Kokoro-chan 19 years old ☆ Finally capture that legendary active Gravure-chan! After all face, bust, style are all god level ☆ There is no rubber in the defenseless uterus that arrives at the house.

  • amateur censoredbig titsamateurinstinst-058inst058413inst-058
    • 2020-10-15
    80 min

    AVKH-179 Takanashi Momoe

  • amateur censoredbig titsamateuravkhavkh-179avkh179avkh-179
    • 2020-10-31
    108 min

    390JAC-067 [Temptation Dirty Ass x Squirting Eroma ● Ko] In addition to the erotic ass, the huge breasts of the F cup that is too big! !! The young lady who attends a super famous university was a spear man who spree using her erotic body! !! 3 conse

  • amateur censoredcreampiebig titsjacjac-067jac067390jac-067
    • 2020-11-06
    477 min

    [OFJE-281]Yua Mikami x Shame Special This National-Grade Idol Is Getting Continuously Fucked 8 Hours

  • yua mikami censoredbeautiful girlsingle workOFJEs1 no 1 styleOFJE-281OFJE281ofje00281
    • 2020-11-19
    131 min

    [JURA-032]It's Her First Time In Her 50s Dear Wife, Here We Are, Once Again. Chikage Misagi

  • chikage misaki censoredcreampiemarried womanJURAcenter villageshibuyajurakuJURA-032JURA032h-086jura00032
    • 2020-12-11
    162 min

    [MDBK-146]Totally Immersive POV Footage! Tied Up Guys x Hard Cowgirl x Continuous Orgasms - Seductive Cowgirl Rodeo Slut

  • shinoda yu aichi michiru censoredcreampiebig titsMDBKbazookarakudaMDBK-146MDBK146h-1496mdbk00146
    • 2021-01-02
    95 min

    [opcyn-141]りん 2(19)

  • amateur censoredamateuropcynopcyn-141opcyn141opcyn-141
    • 2021-01-09
    147 min

    [IPX-601]My Girlfriend Is A Smoking Hot Lingerie Model - Corrupted By Her Own Employer, Made To Fuck On Film Nanami Misaki

  • nanami misaki censoredlingeriesingle workIPXidea pocketdishIPX-601IPX601ipx00601
    • 2021-01-10
    74 min

    300NTK-499 [Inviting Nasty Wife] A perverted woman in a coat with erotic underwear on the finest dirty BODY! ？？ Inside the brain miso is a idiot that occupies SEX & Ji ○ Ko! ？？ Body and tech are super-class Echiechi technique Impulsive cheating s

  • amateur censoredcreampiemarried womanntkntk-499ntk499300ntk-499
    • 2021-01-12
    126 min

    [GONE-026]This Lovey-Dovey Slut Is An Unattainable Flower She's Domesticating This Chubby NEET Nerd Loser Piece-Of-Shit Motherfucker Like A Stray Cat.

  • censoredcreampiebig titsGONEmercurya fair skinned elder sisterGONE-026GONE026h-1133gone00026
    • 2021-01-15
    191 min

    [DOCP-272]Uber Fucks: We Send A Hottie Fresh To You Doorstep! "Wanna Try Some With Me？" You Ask, And Slip This Slut An Aphrodisiac! "I'm Cumming Again!" For Limitless Orgasmic Sex!

  • emily hikari sakuraba monami bell censoredsquirtingDOCPprestigedoc premiumDOCP-272DOCP272118docp00272
    • 2021-01-22
    74 min

    [orex-204]さとみさん

  • amateur censoredcreampieamateurorexorex-204orex204orex-204
    • 2021-01-25
    99 min

    [SPRBD-043]戸惑いのラストピース/中山琴葉

  • censoredSPRBDintec incSPRBD-043SPRBD043h-706sprbd00043
    • 2021-01-29
    51 min

    490FAN-088 Kaori

  • amateur censoredbig titsmarried womanfanfan-088fan088490fan-088
    • 2021-01-30
    186 min

    [WAAA-027]If You Can Endure Rika Aimi`s Awesome Techniques You Can Have Creampie SEX With Her!

  • rumi tadami censoredcreampiebig titsWAAAwanz factorywanzWAAA-027WAAA027waaa00027
    • 2021-02-18
    70 min

    [SIROR-050]Rent-A-MILF - The Hidden Side Of Mature Wives Their Husbands Never See File. No. 50 -

  • censoredcreampiebig titsSIRORdispatched.comSIROR-050SIROR050h-1492siror00050
    • 2021-02-19
    50 min

    FC2PPV 1693192 [First shot] I had a good time with that girl with a lovely smile ♥♥ * With a bonus ♥♥

  • amateur uncensoredfc2
    • 2021-02-20
    64 min

    C0930 ki210221 Miu Shinohara 31years old

  • amateur uncensoredc0930
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-22
    70 min

    300MIUM-682 Ero Ero G cup beauty body wife! !! → [Beautiful young wife celebrity who manages her own beauty treatment salon! Sensitive slender BODY that sways and sways and blows tide during breasts and massage! !! ] × [The reality of an unfussy and

  • amateur censoredcreampiebig titsmiummium-682mium682300mium-682
    • 2021-03-02
    125 min

    [STARS-356](Enjoy Yourself In 4K!) Big Titty Cosplayers! Titty Fucking Full Course Brothel Kurumi Hanamaru

  • hanamaru kurumi censoredbig titscosplaySTARSsodzach araiSTARS-356STARS3561stars00356
    • 2021-03-03
    73 min

    326EVA-144 Drink a guarantee at the pool pick-up immediately Paco ☆ If you switch on, you will not know the ceiling! Suppress Mutsurisukebe, who is weak to push, with the power of gold ww

  • amateur censoredamateurevaeva-144eva144326eva-144
    • 2021-03-23
    59 min

    326HGP-007 [Dirty Angel, Advent! !! ] The fascinating hip line is a lump of eros ♪ Full operation of the sperm factory with a back muscle blowjob like licking candy ⇒ 2 consecutive shots confirmed! !! Yoga goes crazy for vaginal cum shot SEX with tip

  • amateur censoredcreampieamateurhgphgp-007hgp007326hgp-007
    • 2021-03-30
    44 min

    292MY-444 Kotono Sawakita 2

  • amateur censoredbig titsmarried womanmymy-444my444292my-444
    • 2021-04-07
    120 min

    [MSA-011](Amateur Videos) (Creampie Raw Footage) 11 Tomoka (21 Years Old) Is A Shaved Pussy Babe She's Using Her Pussy's Sensors To Search Out Cocks And Spreading Her Legs For Some Big Time Fucking! She Kept On Screaming, "This Feels So F

  • amateur censoredcreampieuniformMSAfuturefuture futureMSA-011MSA011
    • 2021-04-24
    61 min

    HEYZO 2509 My Brother Steals My Nice Figure Wife – Nana Nanami

  • nana nanami uncensoredcreampieheyzo
    • 2021-05-15
    61 min

    1Pondo 051521_001 Seducing by Flashing Pussy: Miyu Morita

  • amateur uncensored1pondo
    • 2021-05-22
    121 min

    390JAC-091 [Saddle Tide Limit Breakthrough x Creampie Facial Cumshot 12 Barrage] Tide! tide! tide! tide! Saddle tide sprinkling libido! It’s still not enough to fire 3P12! Ultimate sex beast presented by Jackson! The ultimate weapon! Do you have

  • amateur censoredcreampiesquirtingjacjac-091jac091390jac-091
    • 2021-06-18
    69 min

    328HMDN-373 [Millionaire’s Play] Nasty Celebrity Wife 25 Years Old A Beautiful Pussy With 5 Saffles. She is an acme with a nipple licking stakeout piston. Mating that squeezes all sperm from a 20-year-old man

  • amateur censoredcreampiemarried womanhmdnhmdn-373hmdn373328hmdn-373
    • 2021-07-07
    27 min

    FC2PPV 1909580 [Individual shooting 44] 21-year-old neat and clean half-striped pie bread cum shot ② Exposure date in uniform

  • amateur uncensoredfc2
    • 2021-07-08
    167 min

    [SPRD-1432]Friends With Benefits With My Best Friend's Mom June Lovejoy

  • june lovejoy censoredmature womanmomSPRDtakara eizokon oriharualeddinSPRD-1432SPRD143218sprd01432
    • 2021-07-18
    26 min

    FC2PPV 1929022 [Limited Number 600pt Off] Beautiful Woman Immediately Shoots 3 People At The Hotel Without Blowjob (Sometimes Irama) ☆ Technician Ol Mika Vol.3

  • amateur uncensoredblowjobfc2
    • 2021-08-13
    280 min

    [DVDMS-700]Faces Finally Shown! The One-Way Mirror Cab Is Parked In Front Of A Famous University To Score Elite College Girl Sex! Hot Pants And Huge Dicks Fucking Raw Edition! Their Perky Booties Sticking Out From Their Teeny Tiny Shorts Plus Lots Of

  • censoredamateurDVDMSdeepsfunky haseithe magic mirrorDVDMS-700DVDMS700dvdms00700
    • 2021-08-15
    67 min

    Pacopacomama 081521_518 Just Keep Fucking The Wife Who Wants To Get Pregnant Misato Wakaba

  • amateur uncensoredpacopacomama
    • 2021-09-04
    59 min

    Pacopacomama 090421_527 The Affair In The Hot Spring Trip: Indecent Circumstances Where Estrus Does Not Stop Hiromi Okura

  • amateur uncensoredpacopacomama
    • 2021-09-17
    180 min

    [PPPD-959]Impure Hetero Affair Covered In Bodily Fluids With Big Tit Mistress Risa Nagata

  • riame nagata censoredbig titssquirtingPPPDoppaiPPPD-959PPPD959pppd00959
    • 2021-09-17
    123 min

    [HZGD-199]Lost In Loving Kissing Creampie Fucking -3 Day Passionate Spa Adultery Trip- Sari Kosaka

  • rin kosaka censoredcreampiebig titsHZGDhitodzuma hanazono gekijouzampaHZGD-199HZGD199h-1100hzgd00199
    • 2021-09-24
    205 min

    [HUNTB-105](I"m Sorry...! I"m Coming!) I Ended Up Sharing A Room With A Haughty Junior Female Employee During A Business Trip. Now She"s Tied Up While I Piston Her And Make Her Come! Sharing A Room With A Coworker Because I Messed Up The

  • censoredcreampieblowjobHUNTBhunterkonnyaku kannohhh groupHUNTB-105HUNTB105huntb00105
    • 2021-10-01
    185 min

    [MIRD-213]Other World Harem Soapland Milks You With Succubus, Furry, And Elf Creampies

  • censoredcreampiebig titsMIRDmoodyzdazai chinpomoodyz realMIRD-213MIRD213mird00213
    • 2021-10-01
    160 min

    [BF-643]My Girlfriend"s Older Sister Is A Super Slutty Bitch! While My Girlfriend Was Away She Came For Me And Gave Me A Compulsory Creampie Fuck Fest! Sarina Momonaga

  • sarina momonaga censoredcreampiebig titsBFbefreerokuyonBF-643BF643bf00643
    • 2021-10-05
    39 min

    FC2PPV 2302512 A Short Stature Loli Girl With Androphobia. Excited By The Young ○ Body Shape And Vaginal Cum Shot Without Permission.

  • amateur uncensoredfc2
    • 2021-10-08
    238 min

    [BBSS-054]The Climax of Excitement is a Squirting Orgasm in Lesbian Sex, 4 Hours

  • tsukino sakura hamazaki mao censoredsquirtinglesbianBBSSbibianBBSS-054BBSS054bbss00054
    • 2021-10-22
    56 min

    552PIEN-001 Non (Rion Izumi)

  • amateur censoredcreampieamateurpienpien-001pien001552pien-001
    • 2021-11-14
    71 min

    300NTK-660 [Inviting Body Soft White Nasty Body Uniform Beautiful Girl P Activity Loss! !! ] Matching Safely With A Uniform P Active Beautiful Girl With A Horny Whip Whitening Body That Evokes A Man’s Instinct! !! A Perfect Score Of 10 Billion!

  • amateur censoredcreampieamateurntkntk-660ntk660300ntk-660
    • 2021-11-19
    149 min

    [JUL-787]When My Big Brother Died, He Asked Me To Look After His Family, So I Decided To Domesticate Both His Wife And Daughter With Creampie Breaking In Training. Reiko Kobayakawa Miu Arioka

  • kobayakawa reiko arioka miu censoredcreampiebig titsJULmadonnaunicorn fukudaJUL-787JUL787jul00787
    • 2021-11-23
    68 min

    STOK-009 Erena (Mirai Natsume)

  • amateur censoredcreampieamateurstokstok-009stok009stok-009
    • 2021-12-01
    82 min

    435MFC-163 [Beauty x Beautiful Breasts x Nice Bottom! Perfect Beauty Body College Girl! ] Even Though I’m Tight, My Chest Is Big And I’m Crazy About Sex At Home With A Female College Student! Forbidden Sneaky Blowjob While Receiving Deliver

  • amateur censoredcreampieamateurmfcmfc-163mfc163435mfc-163
    • 2021-12-05
    65 min

    230OREC-951 Yuuri-San (Yuri Asada)

  • amateur censoredcreampiebig titsorecorec-951orec951230orec-951
    • 2021-12-10
    168 min

    [BBAN-354]Beautiful Ass Lesbian Pet Wannabe Woman - A Space For Just The Two Of Them Where Their Tongues Intertwine And They Get Wild - Luna Tsukino Ichigo Aoi

  • tsukino luna aoi strawberry censoredlesbianBBANbibianBBAN-354BBAN354bban00354
    • 2021-12-24
    146 min

    [JUL-803]Cute, Beautiful, Sexy. A Married Woman With Many Faces, Yukari Shizuki, 29, AV DEBUT

  • shizuki yukari censoredmature womansingle workJULmadonnamametaro mamezawaJUL-803JUL803jul00803



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi