fumiko otowa




FC2KSBJVEMAHODVBLKDASDSHKDAUKGGVHAWDSQTEEBODNATRMEYDFSDSSCESDSANHDKAAVSACJODMILK

2020-10-02
302 min

[HEZ-213]Best Love Hotel Videos From All Over Japan - 50 People, 5 Hours PART. 2

  • censoredmature womanHEZhot entertainmentmarried woman hot entertainmentHEZ-213HEZ21359hez00213
    • 2020-10-19
    63 min

    SIRO-4306 [First shot] [Punipuni mochi BODY with outstanding sensitivity] [Supreme milk butt] Gap full-open small devil SEX that does not seem to be a girl with little love experience. Show off the service that sticks with a sticky body .. AV applica

  • amateur censoredamateursirosiro-4306siro4306siro-4306
    • 2020-10-23
    239 min

    [NANX-210]We Met This Mother And Daughter In Town Who Were Like BFFs, So We Asked Them To Participate In A Sexy Interview, And Then We Had Ourselves Some Mother/Daughter Sandwich Sex, And Now, They Can Never Tell Daddy About What They Did Today!! 7

  • censoredbig titsamateurNANXnanpa heavenNANX-210NANX210h-891nanx00210
    • 2020-10-24
    136 min

    [CAWD-134]Rare Discovery! Adorable Former Newscaster With A Voice That'll Make You Rock Hard - Female Announcer Tsumugi Narita Makes Her Hard-Grinding Cowgirl Porn Debut

  • narita tsumugi censoredhandjobsingle workCAWDkawaiimametaro mamezawaCAWD-134CAWD134cawd00134
    • 2020-10-28
    84 min

    259LUXU-1337 Luxury TV 1319 A tutor who has both intelligence and a glamorous body that slaughters a man appears on AV! A big butt full of destructive power that attracts attention as well as abundant big breasts that make a man feel like that! Every

  • amateur censoredbig titsamateurluxuluxu-1337luxu1337259luxu-1337
    • 2020-11-06
    68 min

    [FTBL-006]Pierced Tongue! Unbelievable Habits! Sunglasses At Night! Bleached Hair! Braless Tube Top! This Osaka Native With High-Class Silver Fox Accessories! Big City Bitch! "Going Down!" As Her Pierced Tongue Swirls Around Your Dick With Th

  • censoredbig titsblowjobFTBLfalenodavielfalenotubeFTBL-006FTBL0061ftbl00006
    • 2020-11-23
    51 min

    FC2PPV 1581246 ☆ First shot ☆ Complete appearance ☆ Exquisite blowjob while making a jubojubo sound ♥ E cup beauty big tits fair-skinned beautiful girl JD and Icharab SEX cum shot ♥ [With benefits]

  • amateur uncensoredfc2
    • 2020-12-04
    60 min

    [PARATHD-3048]Will The Massage Girls At Business Hotels Get You Off？ (8) - Nonomiya's Tits Are So Huge She's Bursting Out Of Her Uniform

  • censoredbig titsuniformPARATHDparadise tvPARATHD-3048PARATHD3048parathd03048
    • 2020-12-12
    118 min

    [MIAA-349]Female Detective Has To Share A Room With A Captured Fugitive - Handcuffed Together And Made To Take His Creampie Ai Mukai

  • ai mukai censoredcreampiedeepthroatMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-349MIAA349miaa00349
    • 2020-12-14
    86 min

    [SHH-011]These Big Tits Sisters Don't Like Me, But I Loosened Them Up With Aphrodisiacs And Now They're Obeying My Every Order In A Reverse Threesome Fuck Fest While My Wife Was Away, I Decided To Conduct A Fuck Comparison With My Stepdaughte

  • censoredbig titsSHHnatural highkansukeSHH-011SHH0111shh00011
    • 2021-01-01
    120 min

    [ONEZ-268](All POV) Sweet Overnight Hotel SEX With My Adorable Girlfriend Yui Nagase

  • yui nagase censoredcreampieblowjobONEZprestigetodoonezONEZ-268ONEZ268118onez00268
    • 2021-01-01
    483 min

    [BAK-052]Big Tits & Rough Sex Special 8 Hours vol. 01

  • censoredcreampiebig titsBAKmadmad burst of laughterBAK-052BAK052h-286bak00052
    • 2021-01-10
    244 min

    [KDMI-031]Climax! Standing Doggystyle!

  • yui hatano mitani akari censoredKDMImiludopamixKDMI-031KDMI031kdmi00031
    • 2021-01-14
    53 min

    230OREC-672 Nozomi sensei

  • amateur censoredcreampieamateurorecorec-672orec672orec-672
    • 2021-01-30
    125 min

    390JAC-081 [End of the century savior G huge breasts GAL x 5 cum shot facials] Fierce fighting dance TURBO! Rainbow aura continuation rate 89 confirmed! A fierce battle against two strong enemies in the AV world! Cum Inside Musou 3P Geki RUSH Creampi

  • ggal censoredcreampiebig titsjacjac-081jac081390jac-081
    • 2021-02-02
    66 min

    FC2PPV 1669624 [First time limited 1980] Beautiful big breasts natural G cup ❤️ Fair-skinned Echiechi body ❤️ Pile driving piston ❤️ Massive vaginal cum shot in a very narrow pussy ❤️ * Review privilege “Semen exploitation with intense handjob w

  • amateur uncensoredfc2
    • 2021-02-06
    42 min

    FC2PPV 1675283 * Uncensored * Dental hygienist’s popular model Arina-chan Part3 Gorgeous 2 shots ♡ M man bullying in raw squirrel + oiran figure without being able to suppress during massage

  • amateur uncensoredfc2
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-13
    58 min

    Pacopacomama 021321_434 Horny mid-age woman who wants to be on top during sex Runa Akasaka

  • amateur uncensoredpacopacomama
    • 2021-02-15
    60 min

    444KING-027 Natsu

  • amateur censoredcreampiesquirtingkingking-027king027444king-027
    • 2021-02-18
    53 min

    [GRMR-034]スローセックスに溶かされて

  • mihina azumihina mihina nagai hiroomi nagase censoredGRMRmura chleo hakusanGRMR-034GRMR034h-1534grmr00034
    • 2021-02-19
    120 min

    [KSBJ-119]A Son's Wife Turned Out To Be A Lewd Woman, Through And Through... Maron Natsuki

  • marin natsuki censoredcreampieblowjobKSBJksb kikaku emmanuellebito sakuraKSBJ-119KSBJ119ksbj00119
    • 2021-02-21
    49 min

    FC2PPV 1657563 [Personal shooting] Innocent loose fluffy female college student ☆ Aya 22 years old remastered version

  • amateur uncensoredfc2
    • 2021-02-25
    122 min

    [IESP-677]Mao Watanabe S********l Takes 20 Creampie Loads In A Row

  • mao watanabe censoredcreampiebig titsIESPienergykikuriniespIESP-677IESP6771iesp00677
    • 2021-04-18
    120 min

    [JSOP-001]New: Alluring Bathhouse Cougar - Passionate Mature Sex At A High Class Soapland Brothel Mio Morishita

  • mio morishita censoredmature womansingle workJSOPglobal media entertainmentyayoi nakanomature japanese soaplandJSOP-001JSOP001jsop00001
    • 2021-04-23
    120 min

    [WAAA-056]"What!？ You Just Came Inside Me Didn't You!？" He Tried To Fake His Premature Ejaculation By Continuing To Piston-Pound Her Pussy Without Pulling Out After Cumming Inside Her And Followed Up With Some More Creampie Cum Shots!! Yu

  • yuzu shirakawa censoredcreampieschoolgirlWAAAwanz factorywanzWAAA-056WAAA056waaa00056
    • 2021-04-26
    53 min

    492JCHA-032 It’s awkward to negotiate a vaginal cum shot for a kid! Immediately Saddle Immediately

  • amateur censoredcreampieuniformjchajcha-032jcha032492jcha-032
    • 2021-04-27
    139 min

    [SDDE-645]Mind-Blowing Shame These Beautiful Nurse Sisters Were Domesticated At The Hospital She Went Undercover At The Hospital In Order To Rescue Her Beloved Little Sister, But Then She Was Won Over And Fucked To Oblivion

  • yoshioka asuka yukine amazawa censoredcreampieblowjobSDDEsod createkei morikawasenzSDDE-645SDDE6451sdde00645
    • 2021-04-30
    241 min

    [HEZ-279]Ravished Cougars 15 Sluts Love To Cum Even As They're Being Corrupted!

  • censoredmarried womanmature womanHEZhot entertainmenthot premium archiveHEZ-279HEZ27959hez00279
    • 2021-05-01
    140 min

    [NKKD-207]When My Husband's Colleague Made Moves On Me ... My Colleague Is Single, Loves Sex Clubs, And Is Unequaled In His Love Of Big Tits, And Now He's Set His Sights On My Wife (And Her Colossal Tits) ... Hana Haruna

  • haruna hana censoredmature womansingle workNKKDjet eizomanji groupNKKD-207NKKD207nkkd00207
    • 2021-05-14
    48 min

    285ENDX-344 Big Tits, Fair-skinned and Good Head! What’s more, I love SEX and I’m not satisfied with it even though I’ve been doing it many times!

  • amateur censoredcreampiebig titsendxendx-344endx344285endx-344
    • 2021-05-15
    161 min

    [CMV-154]Smart-Looking Female Teacher Frequents An S&M Massage Parlor

  • niwa sumire rin hitomi censoredslutCMVcinemagicmarukatsuvixenCMV-154CMV154cmv00154
    • 2021-05-20
    74 min

    [REBD-556]Hana 2 Big Titty High Tension! Hana Haruna

  • haruna hana censoredsingle workREBDrebeccaherpes takaREBD-556REBD556h-346rebd00556
    • 2021-06-30
    241 min

    [RD-1065]Horny Showa MILF Special 6 Mature Girls, 4 Hours - They Say They Don't Want It, But Their Wet Snatches Tell A Different Story

  • censoredmarried womanmature womanRDathena videoathenaRD-1065RD1065149rd01065
    • 2021-07-02
    98 min

    [ADN-327]Forgive Me, Darling... The Pitfalls Of Age-Gap Marriages Natsu Tojo

  • natsu tojo censoredsingle workdramaADNattackersnagira kenzootona no dramaADN-327ADN327adn00327
    • 2021-07-06
    78 min

    345SIMM-651 [NTR] Cuckold A Mysterious Newlywed Wife! A married woman who is excited about the body of a male nude model will forgive even brood parasite seeding … [Memorial nude photo shoot]

  • amateur censoredcreampiebig titssimmsimm-651simm651345simm-651
    • 2021-07-17
    240 min

    [REXD-373]If You Use This You Can D***k Muddy Water... The Trap Hidden In Filtered Water! "Go Ahead, D***k, D***k!"

  • censoredcreampieREXDredmanji groupREXD-373REXD373rexd00373
    • 2021-08-14
    241 min

    [AQMB-026]Mommy"s Tennis Club, Wife"s Creampie Lesson At Hom After Practice, 4 Women

  • shinoda yu kana morisawa kanako iioka censoredcreampiemature womanAQMBaqua mall heroaqua mallAQMB-026AQMB026aqmb00026
    • 2021-08-15
    56 min

    FC2PPV 2028583 [Top Secret Video] Complete Appearance! A Slender Beautiful Girl Who Has Just Moved To Tokyo At The Age Of 18 And Is At The Level Of Noosaka! A Top Secret Video Of Two Consecutive Vaginal Cum Shots Before The Idol Trainee Debuts!

  • amateur uncensoredfc2
    • 2021-09-02
    78 min

    494SIKA-106 De M Daughter Who Exploded Sexual Desire Betrays Her Boyfriend And Sex With Ojisan

  • amateur censoredcreampiebig titssikasika-106sika106494sika-106
    • 2021-09-04
    240 min

    [MMMB-056]Tight Leggings Hugging Her Ass And Pussy. Pimply Huge Ass And Legs Housewife 4 Hours

  • censoredbig titsMMMBmellow moonMMMB-056MMMB056mmmb00056
    • 2021-09-04
    240 min

    [MMB-381]Once You Fuck Her, You"ll Never Forget Her! 10 Ladies With The Ultimate Marshmallow-Soft Bodies Who Feel So Good You"ll Just Have To Cum Inside Them

  • sakura chinami ayanami mako censoredcreampiebig titsMMBmomotarou eizou shuppanishikiribashi hakasemomotaro bestMMB-381MMB381mmb00381
    • 2021-09-24
    222 min

    [HUNTB-103]My Perverted Distant Cousin Loves Sucking Me Off And Won"t Let Go When She"s Between My Legs! It"s The First Time Meeting Her In Many Years After Growing Up. She Still Looks Innocent

  • censoredcreampieschoolgirlHUNTBhunterkonnyaku kannohhh groupHUNTB-103HUNTB103huntb00103
    • 2021-09-25
    239 min

    [OKAX-776]Amateur Seduction! How Far Will You Fuck While Wearing Masks Or The Plastic Wrap？ 240 Minutes.

  • censoredamateurhandjobOKAXk m producedick mandokuokazuOKAX-776OKAX776okax00776
    • 2021-10-01
    182 min

    [GAS-489][FANZA Digital Exclusive] Special Sucking, Groping, And Titty Fucking You Can Only See In Colossal Tits Mania, Titogenic Shiori Tsukada

  • shiori tsukada censoredbig titscosplayGAScinema unit gasmori tetsuyagasGAS-489GAS48971gas00489
    • 2021-11-08
    77 min

    345SIMM-675 [NTR] Husband Who Gets Excited When His Wife Flutters With Another Man … Planning Close-Up Nude Shooting With A Young Handsome Model. Even If My Wife Says No, She Ends Up Being Slimy ● I’m Attracted To This … Peep Into The

  • amateur censoredmarried womanamateursimmsimm-675simm675345simm-675
    • 2021-11-09
    80 min

    534IND-009 Rumored Super Popular Jimaru P Active Beautiful Girl And Translated Ali Yen Active Virgin W Manko Continuous Creampie 3p Creampie Video Outflow Ww Satisfaction Half-Satisfaction …

  • amateur censoredcreampiebig titsindind-009ind009534ind-009
    • 2021-11-12
    119 min

    [PPPD-978]You"ll Get A Sensual Awakening While Tied Up, Until Your Balls Are Drained Dry! (Cock Tip Tweaking, Mandatory Ejaculations, Man Squirting) A Maso Sensual Health Club Where You"ll Be Drained Through Ecstatic Ejaculations Mina Kitano

  • mina kitano censoredbig titssingle workPPPDoppaiPPPD-978PPPD978pppd00978
    • 2021-11-19
    240 min

    [HUNTB-145]The Worst Reunion Of All Time! It Was Supposed To Only Be A One Night Stand! He Ran Into A Sch**lgirl And His Stepdaughter Who He Fucked When They Were Out Hunting For Sugar Daddies! And To Make Matters Worse, She Brought Along Another Gir

  • censoredcreampieuniformHUNTBhunterkawajirihhh groupHUNTB-145HUNTB145huntb00145
    • 2021-11-19
    200 min

    [HUNTB-150]"It"s Not Sex If It"s Through The Underwear Right？ So Put It In..." I Put It In My Younger C***dhood Friend Who Wanted To Play Sex In Underwear!

  • censoredcreampieschoolgirlHUNTBhuntervolvo nakanohhh groupHUNTB-150HUNTB150huntb00150
    • 2021-11-19
    128 min

    428SUKE-097 [Do Not Stop Ejaculation With A Different Dimension Of Handjob] Do You Have A Day And Night Face？ !! Mutsurisukebe’s Sana-Chan Is Often Seen As An Unfussy Person, But Azatosa’s Iq130over! !! Look At The Pride Of The Sucking Mout

  • amateur censoredcreampiesquirtingsukesuke-097suke097428suke-097
    • 2021-11-22
    34 min

    FC2PPV 2452577 First Shot! !! Limited Number! [Uncensored] Encounter With A Neat And Clean Woman … Creampie In A Beautiful Woman Who Feels Climax Many Times And Distorts Her Face And Writhes In Disorder! !!

  • amateur uncensoredfc2
    • 2021-12-03
    56 min

    FC2PPV 2484058 [No] First Shot ♥ 20-Year-Old Short Hair, Shy Ubu Girl Made Her Av Debut ♡ I Put A Lot Of Adult Radical Play Into An Immature Sensitive Body WW

  • amateur uncensoredfc2
    • 2021-12-18
    155 min

    [MMKZ-105]Her Huge Ass Is Plump And Bouncy Tamaki Kurumi

  • tamaki walnut censoredsingle workMMKZmarrionmiyamoto kojirouirisMMKZ-105MMKZ105mmkz00105
    • 2021-12-21
    45 min

    H0930 ki211221 Sara Kanzaki 32years old

  • amateur uncensoredh0930
    • 2021-12-23
    121 min

    [FSDSS-334]Convulsions, Shrimping, Cumming, Extreme Climax, Vagina Bug Juice, Awakening Trance Orgasm Sex Rin Natsuki

  • rin natsuki censoredsquirtingFSDSSfalenoskyscraperfaleno starFSDSS-334FSDSS3341fsdss00334



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi