inori




FC2AUKSSPRDCHRVSQTESTARSHDKACAWDVENXDASDGVHBLKJULRBDSDABMIDESSISMEYDVEMACJODMIDV

2020-09-06
250 min

[SORA-265]A Crazy Exhibitionist Goddess Amateur Babes Who Are Secretly Hooked On Fucking In The Open Air Because They're Shameful Exhibitionist Bitches

  • censoredbig titsamateurSORAyama to sorahimu lockSORA-265SORA265sora00265
    • 2020-09-13
    47 min

    300NTK-432 Growing H Cup Beauty Big Breasts Beauty In 3p 4 Cum Shot Of Angry Waves! ! Oma Of Tapu Tapu In The Vagina ● Ochi With Full Max Co-Tank ● Pleasure Opened By Skewered Sex On The Top And Bottom With Two Co-Tanks Gachi Ascension At The Door Of

  • hsexww censoredcreampiebig titsntkntk-432ntk432300ntk-432
    • 2020-09-23
    40 min

    S-Cute 796_sena_02 A good girl and pajamas H / Sena

  • sena censoredamateursenasena-02sena02796-sena-02
    • 2020-09-26
    170 min

    [MIRD-206]Hiring Four Call Girls With Big Tits For All-Night Creampie Fucking After You Won The Lottery! R\

  • aki erie arai erie yuka osawa natsuho imai censoredcreampiebig titsMIRDmoodyztrendy yamaguchimoodyz realMIRD-206MIRD206mird00206
    • 2020-10-09
    49 min

    [OKGD-032][Secretly Filmed!] Full-Throttle Sex To The Back Of The Vagina With A Popular Callgirl Who Likes Big Cocks

  • censoredamateurblowjobOKGDhggOKGD-032OKGD032h-1347okgd00032
    • 2020-10-24
    144 min

    [JUKF-051]My Sister-in-law Is Cheeky!! Mitsuki-chan - Mitsuki Aya

  • aya mitsuki censoredcreampiebig titsJUKFjumpjump avJUKF-051JUKF051h-227jukf00051
    • 2020-10-24
    241 min

    [SGSR-266]Street Corner Amateur Channel - Married Woman Gives Herself To A Younger Guy She Doesn't Even Know For A Creampie On Her Ovulation Day Gorgeous Wife Special 4 Hours

  • censoredcreampieamateurSGSRbig morkaleigyochuushinsengumiSGSR-266SGSR26657sgsr00266
    • 2020-11-05
    74 min

    [REBD-506]Suzu4 Smile of hope - Suzu Honjo

  • suzu honjo censoredsingle workREBDrebeccahellpess takaREBD-506REBD506h-346rebd00506
    • 2020-11-19
    478 min

    [OFJE-277]Once In A Lifetime! Nervous Interview In Front Of The Camera & First Undressing Scene Making Her Heart Race! 8 Hours Of Uninterrupted Scenes To First Penetration Sex! The Latest S1 Actresses Uncovered Special Large Release!

  • hinana is non nine yoshitaka censoredbig titsblowjobOFJEs1 no 1 styleOFJE-277OFJE277ofje00277
    • 2020-11-20
    42 min

    FRYD-015 Niina

  • amateur censoredbig titsamateurfrydfryd-015fryd015fryd-015
    • 2020-11-27
    125 min

    [KNMB-007]Hinako Takes It Raw #Tall Office Babe With Beautiful Legs #Real Estate Agent #She Wants It Bareback #No Condoms Allowed #The Pantyhose Stays On Hinako Mori

  • hinako mori censoredcreampiesingle workKNMBfirst star100 raw styleKNMB-007KNMB007h-491knmb00007
    • 2020-11-29
    148 min

    [LULU-047]"Your Dick Is So Bundled Up! I'm Going To Peel You And Make You Nice And Clean" My Big Tits Big Stepsister Works For A Bathhouse And She Started Cleaning My Uncircumcised Cock And Then She Used Her Sexy Body To Give Me All The N

  • yu asakura censoredcreampiebig titsLULUlunaticsluminaxLULU-047LULU047lulu00047
    • 2020-11-30
    73 min

    484SD-006 Show me your feats! Case2 Special skill is sports instructor! I was nervous if I was taught soft body and basic exercise, or incontinence with work clothes! If you attack it as it is, it will be super erotic! Asking for yourself, the second

  • amateur censoredamateursdsd-006sd006484sd-006
    • 2020-12-01
    61 min

    HEYZO 2406 After 6 -I Can’t Hold Back Sexual Urge- – Yui Minami

  • yui minami uncensoredcreampieheyzo
    • 2020-12-04
    115 min

    [PARATHD-3060]A Crowd Of Adorable Girls! French Kisses x Body Fluids Live Broadcast - Complete Edition

  • chiharu miyazawa kiriyama yuu censoredbeautiful girlPARATHDparadise tvPARATHD-3060PARATHD3060parathd03060
    • 2020-12-05
    54 min

    FC2PPV 1588931 [Personal shooting] First shot! Minami 22-year-old shaved slender beauty ★ Aviation-related office lady takes SEX for the first time in her life! Of course I will vaginal cum shot raw!

  • amateur uncensoredfc2
    • 2020-12-08
    59 min

    345SIMM-569 Home affair where a model married woman twists a slender body and devours another stick

  • amateur censoredcreampiemarried womansimmsimm-569simm569345simm-569
    • 2020-12-24
    39 min

    FC2PPV 1618314 [Personal shooting] ♀ 250 Reading More ◯ -chan 18 years old SP01 2020 Christmas special edition! A beautiful girl is conceived as a child seed juice gift (laughs)

  • amateur uncensoredfc2
    • 2020-12-24
    69 min

    H0930 ki201224 Mineko Kushida 45years old

  • amateur uncensoredh0930
    • 2021-01-06
    26 min

    FC2PPV 1634353 Main story appearance ( Off-shot ♡ This is a video of a natural body) I made him masturbate with drunken momentum in plain clothes. Because the ass hole is too tingling, I do not want to be patient and put a cock in the mouth pussy and

  • amateur uncensoredfc2
    • 2021-01-08
    150 min

    [HODV-21540]Peeping At A Married Woman's Adulterous Love Affair Through The Rear Window - Reika Hashimoto

  • reika hashimoto censoredsingle workHODVh m pHODV-21540HODV215405642hodv21540
    • 2021-01-08
    62 min

    Pacopacomama 010821_416 Ayumi Tsuji

  • ayumi tsuji uncensoredcreampiebig titspacopacomama
    • 2021-01-22
    51 min

    [oretd-831]MIU

  • amateur censoredcreampiebig titsoretdoretd-831oretd831oretd-831
    • 2021-01-28
    127 min

    [MOND-209]My Sexy Boss Miho Takasugi

  • miho takasugi censoredsingle workMONDtakara eizohotate ikkandaiichi housouMOND-209MOND20918mond00209
    • 2021-03-03
    92 min

    FC2PPV 1709725 [Personal shooting / set sale] Two other sticks that the husband eats while taking his daughter to the hospital Complete version

  • amateur uncensoredfc2
    • 2021-03-05
    91 min

    [SACA-018]A Married Witch's Shaved Pussy!/Mako

  • amateur censoredmarried womanSACAorustak softSACA-018SACA018
    • 2021-03-11
    168 min

    [FSDSS-187]Newcomer Porno Debut Of Modern Flat Chested Girl With A Sweet And Devilish Faith Momo Honda

  • honda peach censoredbig titssingle workFSDSSfalenosatoshi maedafaleno starFSDSS-187FSDSS1871fsdss00187
    • 2021-03-13
    126 min

    [CEAD-332]I'm A Horny Masturbationist And I've Gone Crazy For Pleasure 12 Himari Kinoshita

  • himari kinoshita himari hanazawa censoredmature womansingle workCEADceleb no tomoCEAD-332CEAD332cead00332
    • 2021-03-22
    98 min

    241GAREA-501 Mizuki

  • amateur censoredbig titsamateurgareagarea-501garea501241garea-501
    • 2021-03-23
    59 min

    326HGP-007 [Dirty Angel, Advent! !! ] The fascinating hip line is a lump of eros ♪ Full operation of the sperm factory with a back muscle blowjob like licking candy ⇒ 2 consecutive shots confirmed! !! Yoga goes crazy for vaginal cum shot SEX with tip

  • amateur censoredcreampieamateurhgphgp-007hgp007326hgp-007
    • 2021-04-14
    164 min

    [ROYD-049]Crammed In Together In A Tiny Bath With My Busty Stepsister. Her Big Tits And Grown Up Body Is Making My Cock Hard - She Begged For My Creampie Over And Over Again For Our Whole Trip. Rin Kira

  • kira rin censoredcreampieschoolgirlROYDroyalkawajirihhh groupROYD-049ROYD049royd00049
    • 2021-05-15
    146 min

    [BBTU-012](Delivery-Only Special Video Included) Titty Fuck Special J-Cup 110cm Unlimited Titty Fuck

  • chitose in the evening censoredbig titssingle workBBTUdogmatenunmy big titsBBTU-012BBTU012bbtu00012
    • 2021-05-16
    61 min

    HEYZO 2527 Cum Swallowing MILF – Chihiro Hinata

  • chihiro hinata uncensoredcreampiecumshotheyzo
    • 2021-05-25
    70 min

    Caribbeancom 052521-001 Sex Orgy : 2 Horny Girls Compete Against Each Other For Hard and Big Dick! Eri Hoshikawa, Maki Kawano

  • eri hoshikawa uncensoredcreampielesbiancaribbeancom
    • 2021-06-08
    140 min

    [MSFH-061]Hot Babe So Desperate For Your Seed She Spreads Her Own Pussy Wide For Your Creampie Konomi Yoshinaga

  • konomi yoshinaga censoredcreampiesingle workMSFHsod createzaku araims sodMSFH-061MSFH0611msfh00061
    • 2021-06-19
    238 min

    [NPJB-059]Tokyo Halo Girl: Total Uniformed Girls Declaration: 4 Hours, 20 Works

  • censoredcreampiebig titsNPJBnanpa japanNPJB-059NPJB059npjb00059
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-06
    94 min

    261ARA-496 [Transcendence Gal] [Absolute Beauty] Hono-chan is here! The reason for her application, who works at a hair removal salon, is "I want you to see my beautiful body ♪" I applied to show off! ？？ [Enchanted slender BODY] A dynamite bo

  • amateur censoredbig titsamateuraraara-496ara496261ara-496
    • 2021-07-26
    81 min

    POW-057 Genius Morimoto

  • amateur censoredbig titsschoolgirlpowpow-057pow057pow-057
    • 2021-07-28
    85 min

    428SUKE-081 [Yukata + Aphrodisiac Flood Sex! ？？ ] Borrow A Mobile Battery And Get Tipsy Yukata Beauty And Pakopako Sp! !! I Can’T Wait To Get To The Hotel, And I Can’T Wait To Blame The Tongue By Car. Fujiyama Splash Dalian Buchi Rise Www [

  • amateur censoredcreampieamateursukesuke-081suke081428suke-081
    • 2021-07-30
    159 min

    [SSIS-139]The Night I Fucked My Beautiful Boss Who They Say Has J Cup Boobs, With My Unterminable Sex Drive. Aka Asuka

  • arisu aka censoredbig titssingle workSSISs1 no 1 stylegoemonSSIS-139SSIS139ssis00139
    • 2021-08-11
    57 min

    500DPL-0032 Raw Creampie Gonzo Makoto-Chan

  • amateur censoredcreampieamateurdpldpl-0032dpl0032500dpl-0032
    • 2021-08-13
    34 min

    FC2PPV 2009143 [No 〇 Positive] Namba High-Priced Assistance ⑫

  • amateur uncensoredfc2
    • 2021-08-18
    125 min

    [GVH-274]Naughty Nurses Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiegrandfatherGVHglory questtakahashi chitsujiGVH-274GVH27413gvh00274
    • 2021-08-20
    180 min

    [VNDS-7088]Picking Up Cougars At A Bar And Taking Them Home For Raw Sex, 180 Minutes

  • censoredblowjobVNDSstar paradisenext11VNDS-7088VNDS7088h-254vnds07088
    • 2021-08-22
    88 min

    FC2PPV 2062581 New Sale Until 9/4! (No) [Powerful Subjective Menes 5 @ Kimono Beauty] Handjob Ejaculation / Shooting Outflow / A Veteran Instructor Who Appears In A Healthy Shop That Should Never Ejaculate ♡ Submerged In A Bewitching Adult Whole Body

  • amateur uncensoredfc2
    • 2021-08-26
    40 min

    H0930 ki210826 Aki Sato 30years old

  • amateur uncensoredh0930
    • 2021-09-04
    142 min

    [LUKE-014]A Slut Of An Older Step Sister Who Engages In Temptation Through Dirty Talk While Being Stuck To You, Tsubasa Hachino

  • yano tsubasa censoredbig titsslutLUKEdigital arkdigital ark dejitarua kuLUKE-014LUKE014luke00014
    • 2021-09-09
    42 min

    FC2PPV 2181553 Limited Number! Appearance! Moved To Tokyo Aiming For "# 2" Trimmer. Creampie While Letting An Innocent 18-Year-Old Girl Say "I Like It. I Love It". Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-09-15
    129 min

    [GVH-291]No. 1: The Worst Shame In Bunny Girl History 7 Mao Hamasaki

  • hamazaki mao censoredbig titssingle workGVHglory questusubashi suiGVH-291GVH291gvh00291
    • 2021-09-28
    79 min

    200GANA-2565 Seriously Nampa, First Shot. 1697 Get A Cute Girl With A Prominent Paisula In Yurakucho ♪ The Sexual Desire That Has Accumulated In The Pool Explodes After A Long Time Of Sex! Squirting Launch! Shake The Big Breasts Of The H Cup And Roll

  • amateur censoredbig titssquirtingganagana-2565gana2565200gana-2565
    • 2021-10-09
    121 min

    [APKH-188][POV] Sheltered Innocent S********l Goes To A Love Hotel And Has Forbidden Sex With Her Tea Ceremony Club Advisor, Starring Reina Usami

  • reina usami censoredcreampieblowjobAPKHaurora project annexhAPKH-188APKH188apkh00188
    • 2021-10-09
    221 min

    [BAZX-310][Completely Subjective] Let"s Have Ovulation Day Impregnation Sex with a Beautiful Maid Girl Who Allows Immediate Fellatio and Sex vol. 002

  • nana matsumoto ai kawana censoredcreampieblowjobBAZXk m producetodobazookaBAZX-310BAZX310bazx00310
    • 2021-10-14
    179 min

    [ZOKU-021]First Time Shots, Satomi Nagasawa, 38 Years Old, Adult Video Debut, Satomi Nagasawa

  • satomi nagasawa censoredmature womansingle workZOKUtakara eizoumimasaka shuntakaraZOKU-021ZOKU02118zoku00021
    • 2021-10-16
    140 min

    [TIKB-123](Diary Of Fucking) Manami Oura Gets Super Slutty After Guzzling A Few While Partying, Now She"s Ready For Full-on POV Fucking!

  • manami oura censoredbig titssingle workTIKBchikichikiba gu mousozokuTIKB-123TIKB123tikb00123
    • 2021-11-06
    163 min

    [FLAV-283]HYPER FETISH High-legged Slutty Queen Hazuki Wakamiya

  • wakamiya censoredslutsingle workFLAVdigital arkdigital ark dejitarua kuFLAV-283FLAV283flav00283



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi