miki matsuzaka




FC2SQTEMIAAGVHNATRMEYDMVSDSHKDMARAVEMAHNDPPPDNNPJGMEMMILKNACRDASDSTARSAUKGSDABCAWD

2020-10-21
54 min

FC2PPV 1541848 My future dream is a beautician ❤️ An active beauty student with big eyes and beautiful F cup beautiful breasts ❤️ On the verge of exploding with a soft F cup fucking ❤️ A large amount of vaginal cum shot in a sensitive shaved pussy th

  • amateur uncensoredfc2
    • 2020-11-06
    37 min

    [gerk-327]ひかる 2

  • amateur censoredcreampieamateurgerkgerk-327gerk327gerk-327
    • 2020-11-27
    120 min

    [DAVK-061]Losing Her Virginity With An HB Pencil! Daydreaming Y********l School Graduate With Zero Real Experience Has Her First Dick Experience With Middle-Aged Man! [Opening Her Pussy Wide Outdoors In The Middle Of The Day] - [Powerfully Squirting

  • censoredcreampieDAVKtmadoujin av clubDAVK-061DAVK06155davk00061
    • 2020-11-29
    61 min

    [inst-074]ともみ(21)

  • amateur censoredbig titsamateurinstinst-074inst074inst-074
    • 2020-12-10
    45 min

    FC2PPV 1601490 [Almost appearing] A slender body nympho married woman, a high-speed self-piston straddling the cock so that the generalized erogenous zone w sticks after drinking Ai ○. De transformation married woman w who rolls up

  • amateur uncensoredfc2
    • 2020-12-11
    481 min

    [PPT-103]Maria Aine 8-Hour BEST PRESTIGE PREMIUM TREASURE Vol. 06 - Enjoy "Maria Aine's" Entire Career Trajectory With All 6 Of Her Films + Unreleased Footage In This Timeless Collector's Edition!

  • maria aine censoredcreampiePPTprestigeprestige premium treasurePPT-103PPT103118ppt00103
    • 2020-12-25
    64 min

    [DHT-217]"You Don't Get Excited By Me, Do You？" An Obedient Wife With Super Small Tits Who Works Hard - Sakura, 28 Years Old

  • censoredmarried womanamateurDHThot entertainmentprotectDHT-217DHT21759dht00217
    • 2020-12-28
    99 min

    FC2PPV 1618650 [Rookie gravure GET] Rena 19 years old from wearing erotic clothes I made my debut this year, and I have made a pure white nice body before being dyed in the industry with an Egui piston

  • amateur uncensoredfc2
    • 2021-01-06
    19 min

    FC2PPV 1634209 142 cm J ○. A useless daughter who goes to communication. She cries when she wants money on her daddy activity site. Because she is, she was washed away without permission to shoot adults other than the promise to meet.

  • amateur uncensoredfc2
    • 2021-01-09
    170 min

    [EBOD-795]Twice The Curves! Juicy Female Flesh! 200 Satisfaction At The Hands Of Double The Lusty Babes At This Men's Massage Parlor Chitose Yuki Yuri Honma

  • chitose in the evening really censoredbig titsslutEBODe bodynao masakiEBOD-795EBOD795ebod00795
    • 2021-01-12
    61 min

    FC2PPV 1642324 Outstanding style M-chan ♀ G-spot intensive development “Do you like this？” Muzzle “Ah” Ah … I like it I like it /// “The vaginal wall is accurately stimulated with my fingers and a meat stick …

  • amateur uncensoredfc2
    • 2021-01-21
    41 min

    FC2PPV 1654089 [Limited quantity] Mari-chan, a whip whip surfer gal, has lost communication, so it will be delivered at once including past works. Many purchase benefits

  • amateur uncensoredfc2
    • 2021-03-03
    120 min

    [GVH-204]A Slutty Married Woman Who Struts Around In No Bra And No Panties Just Moved In Next Door! Ameri Hoshi

  • star ameri censoredslutsingle workGVHglory questkabin kizakuraGVH-204GVH20413gvh00204
    • 2021-03-05
    80 min

    [LVID-016]Filthy Part Time Job ~ I Didn't Know I'd Have To Do This... ~ Reiko Fukushima

  • fukushima reiko censoredsoloworkLVIDorustak softloveidolLVID-016LVID016
    • 2021-03-12
    112 min

    [FTHT-009](Shocking Silent Goddess Swooning With Earth-Shattering Orgasms!) Face-Fucked While Laying On Her Side - See The Cock Bulge In Her Cheeks! She Takes Every Thrust With Teary Eyes! She Cums Over And Over Again For The Camera, Her Back Arched

  • censoredcreampiesquirtingFTHTfalenodavielfalenotubeFTHT-009FTHT0091ftht00009
    • 2021-03-13
    116 min

    [OIGS-037]This Married Woman Is Hooked On Bondage She's Unable To Tame Her Desire For S&M Mitsuki Nagisa

  • scooping censoredbdsmsingle workOIGSavs collector susubashisuiavscollector sOIGS-037OIGS037oigs00037
    • 2021-03-15
    240 min

    [PYM-368]Self Shots Girls Film Themselves Getting Horny And Masturbating

  • censoredPYMprimoPYM-368PYM368h-283pym00368
    • 2021-03-18
    320 min

    [DVDMS-643]Faces Revealed!! The Magic Mirror Number Bus 2-Disc Set 8 Fucks! An On-The-Street Investigation! Can A Man And A Woman Truly Be Friends!？ We Investigate The Friendships Between A Real Amateur College S*****t Boy And Girl By Placing Them In

  • censoredcreampieamateurDVDMSdeep sfunky hasegawathe magic mirrorDVDMS-643DVDMS643dvdms00643
    • 2021-04-13
    116 min

    [STARS-360](Get Your Nookie On In Overwhelming 4K Video!) Her True Nature: A Neo Slut Kaede Hiiragi This Predatory Beautiful Girl Will Use Both Her Holes To Devour Maso Men's Cocks! Listen To Her Suck And Slurp While Giving A Blowjob And Get Men

  • hiiragi kaede censoredbeautiful girlsingle workSTARSsod createdragon nishikawasod starSTARS-360STARS3601stars00360
    • 2021-04-18
    143 min

    [APKH-171]A Spoiled Brat Perverted Bitch! She Attends A College Located Near The Metro Station Line That Departs From Shinjuku, And While Commuting From Cock To Cock, She's Cumming On A Daily Basis #Crazy For Sugar-Daddy-Hunting Sex Nagi Kamo

  • kamo nagi censoredcreampieblowjobAPKHaurora project annexhaurora project anexAPKH-171APKH171apkh00171
    • 2021-04-18
    163 min

    [DGCEMD-002]- Streaming Only! With Special Footage - I Bought A Sex Doll That Does What I Want Hikari Sena

  • hikari sena censoredbig titsmature womanDGCEMDcelebrity friendsDGCEMD-002DGCEMD002dgcemd00002
    • 2021-04-21
    72 min

    [TOTTE-017]Mina (TOTTE-017)

  • censoredcreampiesquirtingTOTTEsadie willenautake it out magic mirror sadistic villageTOTTE-017TOTTE0171totte00017
    • 2021-04-22
    124 min

    [HAVD-1007]The Kissing Lesbian Series, Drenched In Adult, Rich And Thick Drool This Horny Babe is Flipping Her Lust To Max Levels And Jumping Head First Into Horny Lesbian Sex!

  • maki kyoko yumina hirosaki censoredlesbianHAVDhibinodr torihamaHAVD-1007HAVD10071havd01007
    • 2021-04-29
    120 min

    [368SKSK-050]ミニマム可愛いパンスト就活生 ビバ！不純異性交遊 永野いち夏

  • amateur censoredcreampieamateursksksksk-050sksk050368sksk-050
    • 2021-05-07
    130 min

    [GUN-853]If You Stretch Your Legs, You Can Be Synchronized Too! I Only Love Long, Thin Legs Now! Tsumugi Narita

  • narita tsumugi censoredsingle workGUNradixmg yukkyexceptionalGUN-853GUN853433gun00853
    • 2021-05-22
    237 min

    [OKAX-742]Pussy Encyclopedia: Anal Twitches! Pussy Licking! Everything In Full View! Turn You On!

  • miharu kawada anri mita yui kawagoe censoredanalslutOKAXk m produceokazuOKAX-742OKAX742okax00742
    • 2021-05-22
    259 min

    [NATR-658]On Display! Reika Hashimoto

  • reika hashimoto censoredmature womansingle workNATRnadeshikoNATR-658NATR658natr00658
    • 2021-06-07
    44 min

    FC2PPV 1857451 [Personal shooting, vaginal cum shot, W privilege, pt off for a limited time] Semen released in the vagina of the body that was tossed with a meat stick inserted for the first time in 5 years …

  • amateur uncensoredfc2
    • 2021-06-10
    92 min

    [HAWA-249]A Cuckold Investigation "I Want To Record My Beautiful Naked Body For Posterity" When She Participated In A Memorial Real Nude Photo Session With A Young Model With A Big Cock, She Began To Drool With Lust And Forgot All About Her H

  • censoredbig titsHAWAcosmos eizomountain forestcosmospictures soft on demandHAWA-249HAWA2491hawa00249
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-20
    120 min

    [MOKO-036]Capturing Working Older Women Masturbating On Film By Setting Up A Secret Camera And Planting Sexy Books and Videos

  • censoredamateurmature womanMOKOstar paradisebumpy roadMOKO-036MOKO036h-254moko00036
    • 2021-07-09
    180 min

    [EBOD-838]Tired of living in self-restraint, I picked up a super horny slut with a G cup in a club. She told me she'd give me a blowjob and in the men's toilet, I came in her mouth. We were still so turned on that we immediately left to fuck

  • censoredbig titsEBODe bodytorendei yamaguchiEBOD-838EBOD838ebod00838
    • 2021-07-10
    61 min

    BINI-291 Mayuri

  • amateur censoredanalamateurbinibini-291bini291bini-291
    • 2021-07-18
    62 min

    FC2PPV 1929271 Limited To July [Nothing] A Debt Wife With Fair Skin. She Is In Trouble With Money, And Although She Hates It, She Is Fucked By Multiple Sticks And Vaginal Cum Shot Is Made Continuously.

  • amateur uncensoredfc2
    • 2021-07-23
    107 min

    [DAVK-066]"So All Of You Are Older Than My Father ..." This Shy And Super Serious Honor S*****t With An Adolescent Body Is Getting Sprayed With Massive Loads Of Semen By Obese Middle-Aged Men In A 7-Way Large Orgies Fuck Fest (She's Cummi

  • censoredcreampieuniformDAVKtmatakashi hashidadoujin av clubDAVK-066DAVK06655davk00066
    • 2021-07-23
    121 min

    [XVSR-607]The Married Woman Makes A Cuckold Of Her Husband While He Is On A Business Trip - Going At It Non-Stop For 26 Hours With Her Neighbor - Hibiki Otsuki

  • otsuki sound censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-607XVSR607xvsr00607
    • 2021-07-25
    48 min

    FC2PPV 1940304 Only 300 [Uncensored] After Vaginal Cum Shot In An In-House Affair Ol, Insert A Toy, Move By Train, Blow In The Toilet, Vaginal Cum Shot Again

  • amateur uncensoredfc2
    • 2021-07-29
    20 min

    HEYZO 2576 Ryou’S Amazing Footjob – Ryou Makoto

  • ryou makoto uncensoredheyzo
    • 2021-08-06
    177 min

    [IPIT-021]引きこもりなのに脱いだら神BODY！日陰のネコ系女子大生AVデビュー 葉風ゆりあ

  • yuria hafu censoredbig titsbeautiful girlIPITidea pocketkyouseiaipoke itsuzai hakkutsu projectIPIT-021IPIT021ipit00021
    • 2021-08-07
    169 min

    [SCPX-430]Teeny Tiny Micro-Bikini And Lotion Makes A Hot Amateur Cutie Blush - It Was Supposed To Be Thigh Sex But She Was So Slippery The Cock Slipped Right In! "I Said Not To Stick It In Me..." But Her Request Is Ignored And Results In A Ho

  • censoredcreampiebig titsSCPXk m producescoop kmpSCPX-430SCPX430scpx00430
    • 2021-08-30
    53 min

    292MY-469 Aihara Sumire 1

  • amateur censoredbig titsmarried womanmymy-469my469292my-469
    • 2021-09-01
    124 min

    [NACR-451]Real College Girls Working In A Part-time Job Where Creampies Are Allowed - Rin Miyazaki

  • miyazaki rin censoredcreampieblowjobNACRplanet plushimurokkushichi ku ryuuNACR-451NACR451h-237nacr00451
    • 2021-09-04
    115 min

    [RPIN-055]I Turned The Calm, Bubbly Teacher Into A Sex Beast!

  • censoredamateurRPINrikopin mousozokuoozora kakeruRPIN-055RPIN055rpin00055
    • 2021-09-06
    59 min

    FC2PPV 2164638 9/10 Made * 2980⇒1280pt: Since The Loss Of Virginity !! 19 Years Old X D Cup Active Jd Kosuzu ♥ "I Will Bother You" Ubu Daughter With Almost Zero Knowledge & Experience That Has Never Been Grasped By Matomo

  • amateur uncensoredfc2
    • 2021-09-09
    120 min

    [FSDSS-282]Secret Forbidden Orgasm SEX At School With Soft Spoken Teacher Ms.Amakawa. Sora Amakawa

  • tenkawa sora censoredbig titssingle workFSDSSfalenotonkatsufaleno starFSDSS-282FSDSS2821fsdss00282
    • 2021-09-17
    67 min

    328HMDN-408 [Individual] A 56-Year-Old Beautiful Wife With A Delicate And Extra-Fine Body. From The First Continuous Cum That Abara Emerges In Threatening Sex With A Young Man ●● Creampie

  • amateur censoredcreampiemarried womanhmdnhmdn-408hmdn408328hmdn-408
    • 2021-09-17
    61 min

    230OREC-885 Misaki

  • amateur censoredcreampieuniformorecorec-885orec885230orec-885
    • 2021-09-29
    59 min

    494SIKA-112 Gully Small Tits J ○ And 3P Sex

  • amateur censoredamateurbukkakesikasika-112sika112494sika-112
    • 2021-10-07
    32 min

    [skck-043]りこ 1

  • amateur censoredanalamateurskckskck-043skck043skck-043
    • 2021-10-29
    122 min

    [JJCC-011]Unfaithful Wife Lusts For Cum, Miyako

  • censoredcreampiemature womanJJCCjuku onna japan emmanuellejuku onna japanJJCC-011JJCC011jjcc00011
    • 2021-11-05
    117 min

    [DASD-932]Black Foreign S*****t NTR. Huge Dick Came To Learn About Different Cultures. Maika Hiizumi

  • maika hizumi censoredcreampieblowjobDASDdasmishima rokusaburoDASD-932DASD932dasd00932
    • 2021-12-02
    103 min

    [IQQQ-028]A Married Female Teacher Who Gets 10 Times Wetter Climaxing During Her Class, When She Can"t Make A Sound Reiko Kobayakawa

  • kobayakawa reiko censoredcreampiemarried womanIQQQcenter villagesouthern earthzora center villageIQQQ-028IQQQ028h-086iqqq00028
    • 2021-12-04
    119 min

    [MGMJ-053]Halo Girl That Loves Masochistic Men Teases Me With Shame Taking My Balls In Her Hands and Giving Concentrated Penis Banging Intercourse. Riria Hyodo

  • riria hido censoredanalschoolgirlMGMJmegamibijo shin fetishMGMJ-053MGMJ053mgmj00053
    • 2021-12-08
    93 min

    [ETQR-321][Daydream POV] Keep Playing with the Nipples! A Slutty Beautiful Girl Visits you to Give Pleasure, Meru Ito

  • ito meru censoredcreampieuniformETQRerotic timeETQR-321ETQR321etqr00321
    • 2021-12-10
    61 min

    [121021-001]Like The Butterflies: Two Wheels Soapland In Pink Street 18

  • amateur uncensoredcreampiehandjobcaribbeancom
    • 2021-12-17
    150 min

    [EBOD-873]I Get This Feeling That We"re Doing Something Naughty ... This Lo*ita Looks Like She"s In The Throes Of Adolescence, And That"s How Her Personality Plays Out Too, But She"s Got I-Cup Titties An E-BODY Exclusive Debut Aria Os

  • aria oshima censoredbig titsbeautiful girlEBODe bodytrendy yamaguchiEBOD-873EBOD873ebod00873



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi