nagase yui




FC2KSBJCESDPREDLULUDASDFSDSSMVSDMILKHMNHNDWAAAGMEMSDABAWDONEZROYDCAWDABWHUNTBKBI

2020-11-09
80 min

FC2PPV 1564129 [Uniform Clothes Saddle Creampie & Squirting] I have assisted with my Echiechi daughter with a matching app! Even though it’s so cute, jungle pubic hair! The untreated bristle pussy that is left raw is bechobecho with man juic

  • amateur uncensoredfc2
    • 2020-11-13
    146 min

    [IPX-567]"I'll Never Forgive Her!!" I Went To A Pink Salon And Out Came That Fucking Bossy Bitch Lady Boss Of Mine, Ms. Nishimiya. And I Thought Our Company Didn't Allow Side Hustles... So In Exchange For Keeping My Mouth Shut, I Trea

  • yume nishinomiya kana suzunan censoredcreampiedeepthroatIPXidea pocketinaballdishIPX-567IPX567ipx00567
    • 2020-11-13
    103 min

    [XRW-943]I Like It - Rei Hanamiya

  • rei hanamiya censoreddeepthroatbdsmXRWreal worksreal real worksXRW-943XRW943172xrw00943
    • 2020-11-17
    80 min

    261ARA-464 [Active female college student] 21 years old [Mechakawa & legs] Sara-chan is here! The reason for her application to go to college is “I want to be a SEX student rather than studying …” I’m full of horny things! [Ch

  • amateur censoredamateuraraara-464ara464261ara-464
    • 2020-11-18
    79 min

    435MFC-055 Shara

  • amateur censoredcreampieamateurmfcmfc-055mfc055435mfc-055
    • 2020-11-23
    62 min

    345SIMM-558 Gonzo date at home after school with a student’s little J ●

  • amateur censoredcreampieuniformsimmsimm-558simm558345simm-558
    • 2020-11-27
    115 min

    [PARATHD-3041]An Amateur Girl And An AV Actress Bet On A Baseball Battle - Complete Edition

  • an sasakura arimura nozomi censoredamateurPARATHDparadise tvPARATHD-3041PARATHD3041parathd03041
    • 2020-11-30
    74 min

    FC2PPV 1589874 [First time limited 1980] A young wife with a child in a rural area is 20 years old ❤️ Accepts a stick of another person raw while busy raising children ❤️ Creampie in the vagina in a beautiful pink pussy ❤️ I do not know how many time

  • amateur uncensoredfc2
    • 2020-12-01
    157 min

    [BDSM-071]Breaking In Record Of Masochist Actress Akari Niimura

  • akari shinmura censoredbdsmsingle workBDSMtightbind maniaBDSM-071BDSM071h-1096bdsm00071
    • 2020-12-12
    152 min

    [MIDE-858]Creampie OK! Female Teacher Miyu Nakamura's Seduction Class

  • miu nakamura censoredcreampiehandjobMIDEmoodyzmoodyz divaMIDE-858MIDE858mide00858
    • 2020-12-15
    55 min

    H0930 ki201215 Hitomi Kojima 33years old

  • amateur uncensoredh0930
    • 2020-12-17
    149 min

    [SSNI-941]Nailing A College Girl With A Quickie After I Spotted Her Bra When Taking Out The Trash Aika Yumeno

  • yumeno aika censoredbig titssingle workSSNIs1 no 1 stylebungo maedaSSNI-941SSNI941ssni00941
    • 2020-12-22
    117 min

    [MSB-003]Fucking Another Man's Wife And Giving Her A Raw Creampie 3! 13 Years Married / Living In Hamamatsu, Shizuoka / 3 K*ds / Beautiful Impish Woman With Shaved Pussy (39) - Insatiable Sex Drive, Black Hair, Neat And Clean Cock-Loving Housewif

  • amateur censoredcreampieamateurMSBfutureMSB-003MSB003
    • 2021-01-06
    481 min

    [YVG-024]21 Girls Get Horny For Real While Showing Off Their Panties And Cum Like Crazy! All-POV Underwear Masturbation Challenge!

  • censoredslutYVGglory questYVG-024YVG02413yvg00024
    • 2021-01-10
    118 min

    390JNT-014 [A sexually explicit spear man who makes a man 1000 squid] I ● SNS picking up a bartender of whip whip BODY who puts an erotic selfie on the star! !! Don’t miss the non-hampered Feratech of Yariman GAL who boasted that “There is

  • amateur censoredcreampiesquirtingjntjnt-014jnt014390jnt-014
    • 2021-01-21
    98 min

    AVKH-191 Honoka Tsujizaki

  • amateur censoredbig titsamateuravkhavkh-191avkh191avkh-191
    • 2021-01-21

    FC2PPV 1653544 * Until noon on the 24th 4480pt → 3980pt [None] Three past works of tall G-cup busty daughter! * New trailer video + high-quality version of the main story with review benefits

  • amateur uncensoredfc2
    • 2021-01-28
    45 min

    C0930 ki210128 Mayumi Ono 30years old

  • amateur uncensoredc0930
    • 2021-02-12
    90 min

    [ZOZO-036]Miss Momo Kato ka

  • censoredcreampiebig titsZOZOsadie willenauZOZO-036ZOZO0361zozo00036
    • 2021-02-19
    300 min

    [KAGP-173]Corner Masturbation - They Can't Stop Rubbing Their Snatches 5 Hours, 39 Girls - Tempted By A Table

  • censoredamateurbeautiful girlKAGPprincess kaguya pt delusional familywife s trapprincess kaguya ptKAGP-173KAGP173kagp00173
    • 2021-02-22
    84 min

    [MCKT-016]Hot Girls Who Love To Party! Girls Pick Up Guys To Fuck On The Street Corner Hibiki Otsuki

  • otsuki sound censoredcreampieMCKTchikikikikama delusion groupMCKT-016MCKT016mckt00016
    • 2021-03-08
    38 min

    [ore-760]Toa

  • amateur censoredcreampieschoolgirloreore-760ore760ore-760
    • 2021-03-12
    127 min

    [BOKD-216]Super Cute Transexual Porn Debut Sex After Having Aphrodisiac Rubbed On Anus And Cock Kohaku

  • censoredanalcreampieBOKDwe re she malessuginokiBOKD-216BOKD216h-995bokd00216
    • 2021-03-12
    69 min

    [orec-720]りかちゃん

  • amateur censoredcreampiebig titsorecorec-720orec720orec-720
    • 2021-03-13
    40 min

    FC2PPV 1725183 [Individual shooting] Erotic back dirt J system of small breasts inverted nipple and raw Paco Enko! I was very excited about the sensitive bicubic reaction [Creampie / Creampie]

  • amateur uncensoredfc2
    • 2021-03-18
    86 min

    [THNIB-070]The Cutest Girl In Class/Sakura Hyakuno

  • censoredbig titsbeautiful girlTHNIBintec incTHNIB-070THNIB070h-706thnib00070
    • 2021-03-22
    121 min

    [KATU-079]This Horny Lawyer Has Her Nipples Rock Hard And Ready Super Horny Double Slut Action With Big Asses And Luscious Areolas

  • censoredslutKATUkatsuo bussan mousouzokumaglowKATU-079KATU079katu00079
    • 2021-03-26
    127 min

    [JUFE-272]My Horrible Step Father Seduces And Licks Me Whenever My Mom Isn't Looking... Mahiro Ichiki

  • mahiro ichiki censoredschoolgirldeepthroatJUFEfitchJUFE-272JUFE272jufe00272
    • 2021-04-09
    120 min

    [MIAA-423]I Live Right Next Door... If I Gave You A Blowjob, Would You Keep It A Secret From Your Girlfriend？ Seduced By My Neighbor With A Shocking Blowjob Until My Balls Are Drained Dry... Yumi Saeki ka

  • yuka saeki censoredblowjobslutMIAAmoodyzsuisei akaieveryone s porn starMIAA-423MIAA423miaa00423
    • 2021-05-10
    116 min

    [TENV-19037]Transsexual Monika & Andrea

  • censoredslutTENVtennin xTENV-19037TENV19037h-1542tenv19037
    • 2021-05-28
    151 min

    [MIAA-445]Looking For A Dick To Suck Cum Swallowing Date With A Girl Who Loves Sucking Cock Marina Saito

  • marina saito censoredblowjobslutMIAAmoodyzeveryone s porn starMIAA-445MIAA445miaa00445
    • 2021-05-29
    156 min

    [LULU-074]The Female Manager Of The Baseball Team Has Light Skin And A Big Ass, And Although She's Dating The Captain Of The Team, She's Been Treating My Sexual Urges Every Day Behind His Back Because I Was Feeling So Discouraged. Rina Takase

  • rina takase censoredcreampieschoolgirlLULUlunaticsluminaxLULU-074LULU074lulu00074
    • 2021-06-14
    72 min

    491TKWA-002 Tsugumi

  • amateur censoredcreampiebig titstkwatkwa-002tkwa002491tkwa-002
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-29
    44 min

    274DBL-0101 It may be JD in the middle of intercrural sex ~ Insert raw raw Hiyori 21 years old

  • amateur censoredamateurbeautiful girldbldbl-0101dbl0101274dbl-0101
    • 2021-07-09
    61 min

    328HMDN-381 [Convulsions Iki Hell With Experience Esthetics] A 29-year-old Married Woman Who Strips White Eyes With A Free Massage And Breaks Slender! ？？ Shrimp warp cum! Pretending to be aroma, acme fell with an aphrodisiac. I love holding it becaus

  • amateur censoredcreampiemarried womanhmdnhmdn-381hmdn381328hmdn-381
    • 2021-07-17
    120 min

    [DASD-892]Newlywed Flirtation With A Beautiful Trans Bride, Starring Sara Aizawa

  • aizawa sara censoredanalbeautiful girlDASDdashiromichi hoseDASD-892DASD892dasd00892
    • 2021-07-21
    37 min

    FC2PPV 1934313 Infiltrate A Secret Orgy ㉞ Perfect Hips ♥ Beautiful Ass Is Crowded With More Aggressive Ossans Than Usual! 5 Thick Sperms Dripping From The Nice Ass ♪ * High Quality Version & Review Benefits Included ★

  • amateur uncensoredfc2
    • 2021-08-13
    295 min

    [SKMJ-196]40 Days Worth Of Peeping Videos! Only A Camera Installed By A Fellow Clan Member Could Get This Close To Big And Little Stepsister Panty Shot Action And No Makeup Body Washing Action Like This In Such Vulnerable Positions, Now Made Public F

  • censoredamateursisterSKMJsekimenjoshisekimen goshiSKMJ-196SKMJ196h-1324skmj00196
    • 2021-08-13
    34 min

    FC2PPV 2009143 [No 〇 Positive] Namba High-Priced Assistance ⑫

  • amateur uncensoredfc2
    • 2021-08-18
    50 min

    FC2PPV 2040117 [No] [Appearance] [Review Benefits] Perfect Beauty Body Amateur Girl, Second Time Because Of Popularity ♡ Gonzo Cum Shot With Oil Massage ☆ Meet In The Car And Shoot In The Car Mouth ☆

  • amateur uncensoredfc2
    • 2021-09-03
    118 min

    [BF-641]She Looks Innocent But She"s Actually A Bitch Who Seduced Her Teacher And Had Sex With Him In A Love Hotel Runa Tsukino

  • tsukino luna censoredcreampieschoolgirlBFbefreeBF-641BF641bf00641
    • 2021-09-05
    79 min

    413INST-155 [God Chippai] [Active Idol] K2 Beautiful Girl Net Idol Cheeky ♀ Bab-Chan And Personal Photo Session Gonzo Immature Pussy Creampie

  • amateur censoredcreampieschoolgirlinstinst-155inst155413inst-155
    • 2021-09-17
    170 min

    [MVSD-481]Mazakon (Oedipus Complex). I Remember Getting My Nipples Played With And Fondled By An Older Guy For Days On End. Mai Kagari

  • flower hunting censoredcreampieschoolgirlMVSDm s video groupms video groupMVSD-481MVSD481mvsd00481
    • 2021-09-24
    237 min

    [SKMJ-210]Amateur Sch**lgirls In A Real Pickup! Male And Female S*****t Boys And Girls Are Out On The Street, And Taking The "If You Can Extract 20ml Of Semen, You"ll Win 100,000 Yen Variety Special" Challenge! She"s Blushing Like A T

  • censoredcreampiebig titsSKMJsekimenjoshikikufukusekimen goshiSKMJ-210SKMJ210h-1324skmj00210
    • 2021-09-25
    129 min

    [CEAD-364]We"ll Teach You How To Love An Emotionally Explosive Girl! Rina Takase If You Give An Emotionally Sensitive Girl Some Tender Love, She"ll Turn Into A Horny Obedient Bitch Who Is Easily Ready To Fuck Anybody!

  • rina takase censoredbig titsmature womanCEADserebu no tomoCEAD-364CEAD364cead00364
    • 2021-10-01
    88 min

    [NNPJ-473]Needing To Embrace A Top Tier Girl. Taking A Girl From Minato With H-cup Tits Along On A Resort Pool Date That"s Too Hot To Handle. Sex-crazed Guy Enjoys Giving 4 Creampie Cum Loads.

  • censoredcreampiebig titsNNPJnampa japanNNPJ-473NNPJ473nnpj00473
    • 2021-10-21
    198 min

    [SW-807]Step-brother Has A Super Lovable Step-sister With No Bra And A Panty Shot For Lewd Temptation! It"s Going To Be Way Too Hard To Resist. Isn"t Her Body Just So Hot Looking These Days？! Ena Satsuki

  • ena satsuki censoredsistersingle workSWswitchraito fuji makotoswitch hibinoSW-807SW8071sw00807
    • 2021-10-22
    124 min

    [FOCS-030]The Industry"s No. 1 Make-Up Beauty Missed Her Last Train Home, So We Tried To Pick Her Up And You Won"t Believe What Happened - Smoking Hot Sex From Dusk Till Dawn! Dual Talents: Porn Star And Skilled Make-Up Artist？! Kaede Hiiragi

  • hiiragi kaede censoredblowjobsingle workFOCSabc mousou zokufocusFOCS-030FOCS030focs00030
    • 2021-10-24
    95 min

    522DHT-0306 Kasumi (Pseudonym) 31 Years Old (Naoko Akase) Who Is No Longer Invited By Her Husband Who Has Been Refused By Her Husband

  • amateur censoredcreampiemarried womandhtdht-0306dht0306522dht-0306
    • 2021-10-24
    46 min

    404DHT-0326 Nori Good Slender Widow And Anal! Rika 48 Years Old

  • amateur censoredmarried womanamateurdhtdht-0326dht0326404dht-0326
    • 2021-12-09
    158 min

    [SPRD-1495]After The Class Reunion... Honoka Tsuji

  • tsujii honoka censoredmature womansingle workSPRDtakara eizoutakara hiroshialeddinSPRD-1495SPRD149518sprd01495
    • 2021-12-10
    136 min

    [JUL-799]Happen To Meet Sexually Harassing Teacher From College Days When Working As Call Girl From That Day Made To be Sex Processing Pet. Runa Tsukino

  • tsukino luna censoredmature womansingle workJULmadonnashiro shotenJUL-799JUL799jul00799
    • 2021-12-11
    61 min

    10musume 121121_01 The School Uniform: It Feels Too Good To Get Goose Bumps Keiko Udaka

  • amateur uncensored10musume
    • 2021-12-25
    55 min

    H0930 ki211226 Yuna Morikawa 24years old

  • amateur uncensoredh0930
    • 2022-01-08
    139 min

    [APAK-211]Her First Time On Film! "Nice To Meet You... I Love Company, And I End Up Putting Out Right Away..." Fresh-Faced Teen In Her School Uniform Goes Wild For Real, Raw Fucks Nika Arakawa

  • arakawa jika censoredcreampieschoolgirlAPAKaurora project annexrkaurora project anexAPAK-211APAK211apak00211



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi