school girl




FC2KSBJNACXCHRVDASDSSNIHUNTBNATRMVSDCJODONEZMEYDMILKCAWDPREDMIDVMIDEADNNNPJFSDSSSDAB

2021-03-07
135 min

[DNJR-046]"I'm Going To Be Breaking In Your Body Alot, Okaaaaaaay？ You Have To Obey Whatever I Say, Okayyyyyyy？" The Spoiled S*****t Council President And Her Maso Man Boy Toy's Journal Of Love Yui Kawai Chiaki Uehara

  • yui kawai chiaki uehara censoredbeautiful girlslutDNJRdog daydreamersmaboroshikoDNJR-046DNJR046dnjr00046
    • 2021-03-07
    75 min

    345SIMM-617 THE Takamine Flower! A divine beautiful girl who reigns at the top of the school caste appears here! !! !! The transparent and beautiful BODY & the idol face that grabs the hearts of boys are disturbed and hope for pregnancy! ？？ The f

  • amateur censoredcreampieuniformsimmsimm-617simm617345simm-617
    • 2021-03-06
    51 min

    210AKO-418 IZUMI

  • amateur censoreduniformschoolgirlakoako-418ako418210ako-418
    • 2021-03-06
    146 min

    [SHKD-932]Beautiful Young Swimmer Girl In Swimsuit Thoroughly Trained By Middle-Aged Man - Asuka Momose

  • momose asuka censoredbeautiful girlsingle workSHKDattackersjo stylesharkSHKD-932SHKD932shkd00932
    • 2021-03-06
    158 min

    [BF-627]I Was Jealous Of My Classmate, Who Was Dating A College S*****t ... So While My Classmate Was At Home, I Spent 2 Days And A Night Furiously Fucking Her Boyfriend. Asuka Momose

  • momose asuka yuuri censoreduniformschoolgirlBFbefreeroku yonBF-627BF627bf00627
    • 2021-03-05
    133 min

    [SKEJ-007]Small Girl With Huge Tits! Beautiful Barely Legal Sumire-chan Loves Sex!

  • censoredcreampiebig titsSKEJtime daydream groupSKEJ-007SKEJ007skej00007
    • 2021-03-04
    61 min

    345SIMM-616 [I cup] [Beautiful breasts] [Women ● Raw] God body J ● that seems to have jumped out of erotic comics is a slimy soap experience!

  • hanacmj censoredcreampiebig titssimmsimm-616simm616345simm-616
    • 2021-03-02
    135 min

    [SDAB-168]This Naughty And Boyish Girl With A Sensual Body Is Twitching And Throbbing And Cumming Like A Cunt And Moaning And Wailing In Ecstasy Like A Wretched Bitch She's Wearing Her Uniform While Engaging In Oiled-Up Massage Sex Nana Hayami

  • don t be quick censoreduniformschoolgirlSDABsodkomatsu 17youthSDAB-168SDAB1681sdab00168
    • 2021-03-02
    56 min

    345SIMM-614 Big butt bullet cowgirl that defenseless character can not be alert

  • amateur censoredcreampieuniformsimmsimm-614simm614345simm-614
    • 2021-03-01
    65 min

    492MERC-236 Nice BBQ swap

  • amateur censoreduniformschoolgirlmercmerc-236merc236492merc-236
    • 2021-03-01
    51 min

    492MERC-237 Nice BBQ swap 2

  • amateur censoreduniformschoolgirlmercmerc-237merc237492merc-237
    • 2021-03-01
    128 min

    [pow-042]ますも

  • amateur censoredschoolgirlamateurpowpow-042pow042pow-042
    • 2021-03-01
    79 min

    469G-633 #Saddle Girl Hinata

  • amateur censoredcreampiebig titsgg-633g633469g-633
    • 2021-03-01
    62 min

    345SIMM-613 Club activity straight J ● Surprising lewd potential if you think

  • amateur censoredcreampieuniformsimmsimm-613simm613345simm-613
    • 2021-02-28
    300 min

    [HPOW-009]The Cum Cum Mirror Channel #02 All New 3 Big New Episodes "Amateur Cum Cum Power" This Beautiful Girl Is Fresh And Pretty, But She Cums Like A Queen During Legendary, Lovestruck Sex Plus 1

  • censoredbig titsschoolgirlHPOWamateur hoihoi delusion groupHPOW-009HPOW009hpow00009
    • 2021-02-28
    137 min

    [MMUS-049]Provocative Devilish Little Beautiful Girl - Himari Kinoshita

  • himari kinoshita himari hanazawa censoredcosplayslutMMUSmarrionkijin kasaikcpMMUS-049MMUS049mmus00049
    • 2021-02-27
    155 min

    [JUKF-056]S*********l Loves Her Step Daddy Mitsuki-chan (Living In Itabashi) Mitsuki Nagisa

  • scooping censoredcreampieschoolgirlJUKFjumpjump avJUKF-056JUKF056h-227jukf00056
    • 2021-02-27
    151 min

    [JUKF-057]Single Dad's Only Daughter - Sweet, Serious Girl With Sexual Feelings For Her Stepdad, Narumi Narumi Hirose

  • narumi hirose censoredcreampiebig titsJUKFjumpjump avJUKF-057JUKF057h-227jukf00057
    • 2021-02-27
    149 min

    [CLUB-629]I Invitied A Dark And Gloomy Girl With Big Tits That I Had A Crush On Home And Secretly Filmed Her. Like A Naive Cherry Boy I Asked Her To Show Me Her Tits And I'll Show Her My Dick, And She Agreed And Ended Up Captivated By The Cock.

  • censoredbig titsschoolgirlCLUBhentai shinshi clubCLUB-629CLUB629club00629
    • 2021-02-27
    121 min

    [WAAA-038]"Huh？! Did You Just Cum Inside Me？!" - He Tries To Cover Up His Premature Ejaculation By Continuing To Piston Fuck Her Even After He's Cum!! - Sora Minamino

  • minano sora censoredcreampieschoolgirlWAAAwanz factorywanzWAAA-038WAAA038waaa00038
    • 2021-02-27
    143 min

    [JKSR-482]10 A.M.: Shouldn't You Be At School, Urara？ Urara Kaon

  • hanaoto urara censoredcreampieschoolgirlJKSRbig morkalobockeyprink junkyJKSR-482JKSR48257jksr00482
    • 2021-02-27
    172 min

    [JUFE-264]College Girl With Colossal Tits In Leotard Gets Relentlessly Trained And Broken In For 10 Days By The Boy Next Door - Hana Himesaki

  • himesaki hana censoredbig titsschoolgirlJUFEfitchJUFE-264JUFE264jufe00264
    • 2021-02-26
    132 min

    [JMTY-045]#SupportFile01 Hinako (Hotel Play 5) Giving A Beautiful Girl In A School Uniform Who Works Part Time After School A Creampie And Making Her D***k Cum

  • censoredcreampieJMTYteacher delusion groupukyo lifeJMTY-045JMTY045jmty00045
    • 2021-02-25
    195 min

    [PIYO-106]These Y********ls Will Give You Hot Nookie Kisses, Drool, And Full-On Face Licking! "I Want To Be Lured To Temptation By A S********l Who Wants To Practically Eat My Face!"

  • censoredschoolgirlbeautiful girlPIYOhyokopiero dabicchiPIYO-106PIYO1061piyo00106
    • 2021-02-25
    165 min

    [SVDVD-844]Shame! The Male/Female Equal Opportunity Special Education Ward Starting This Year, Every Monday Will Be Declared An All-Nude Day 2021 New School Semester Edition

  • akane shiki yuki s censoredcreampiesquirtingSVDVDsadistic villageista girl and her shameSVDVD-844SVDVD8441svdvd00844
    • 2021-02-25
    93 min

    [OKS-106]Wet And Shiny, Perfectly Fitting Godly Swimsuit: Minano Sena Is Enjoying Her Cute Girls' School Swimsuit! This AV Starts With A Voyeur Video Of Big And Small Breasts And Moves On To A Number Of Fetish CLose-ups, Such As Shaved Pussies, H

  • minano sena censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-106OKS1061oks00106
    • 2021-02-25
    123 min

    [FSDSS-174]Saliva~ (Heart) Beautiful Y********l in Uniform`s Wet Kissing Fuck - Ena Satsuki

  • ena satsuki censoredbig titsschoolgirlFSDSSfalenoflagmanfaleno starFSDSS-174FSDSS1741fsdss00174
    • 2021-02-24
    76 min

    SWEET-052 Sakurasaku

  • amateur censoredschoolgirlamateursweetsweet-052sweet052sweet-052
    • 2021-02-23
    61 min

    HEYZO 2467 Lewd Nana In Sexy Sheer School Girl Costume – Nana Natsume

  • nana natsume uncensoredcreampiecumshotheyzo
    • 2021-02-22
    141 min

    [APAK-191]A Salacious And Orgasmic S*****t Training Trip This Voluptuously Big Tits S*****t Couldn't Say No, So She Tearfully Got Fucked To Orgasmic Heaven ... Nanami Ozora

  • nanami ozora censoredcreampieschoolgirlAPAKaurora project annexrkaurora project anexAPAK-191APAK191apak00191
    • 2021-02-21
    82 min

    345SIMM-612 Super super huge breasts! Keep an eye on the sensitive decameron that is overflowing with www about the matter of having the best love love holiday by eating and playing with the miracle I cup J ○! Wrap your uncle in a nice fluffy body th

  • amateur censoredbig titsuniformsimmsimm-612simm612345simm-612
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-20
    76 min

    345SIMM-611 Boyish & small sport compact J ○ is a lewd girl who brings an electric massage machine to school and masturbates! Good at sports is good at the floor! ？？ Climax with a healthy fair-skinned body! Eyes are distorted with pleasure by rep

  • amateur censoredcreampieuniformsimmsimm-611simm611345simm-611
    • 2021-02-19
    37 min

    FC2PPV 1693403 Weekend only [Individual shooting] Prefectural general course ② Curious black-haired girl. She is Gonzo by a cram school teacher.

  • amateur uncensoredfc2
    • 2021-02-19
    96 min

    [SUJI-129]Selfish S*****t Chiharu Is Men's Desire

  • censoredcreampiebeautiful girlSUJIkanranshaSUJI-129SUJI129suji00129
    • 2021-02-19
    135 min

    [TIKB-102]Sex Films With Freaky Older Guys Rei Kuruki

  • satoshi kuruki censoredcreampiebeautiful girlTIKBtikitiki.comerTIKB-102TIKB102tikb00102
    • 2021-02-19
    117 min

    [MGMJ-047]Beautiful Girl Loves Male Subs - She Teased My Balls And Fucked Me With A Strap-on Narumi Hirose

  • narumi hirose censoredanalschoolgirlMGMJmegamibeautiful goddess fetishMGMJ-047MGMJ047mgmj00047
    • 2021-02-17
    93 min

    SWEET-051 Mizuzu

  • amateur censoredschoolgirlamateursweetsweet-051sweet051sweet-051
    • 2021-02-14
    94 min

    345SIMM-606 A small J ○ who is too nasty regardless of the innocent appearance, licks with a long tongue and slurps and serves paradise ♪ ♪ It’s been a long time with an uncle and it’s alive and it’s a tide Creampie! !! !! [A special d

  • amateur censoredcreampieuniformsimmsimm-606simm606345simm-606
    • 2021-02-13
    140 min

    [SQTE-359]Your Girlfriend (Who Looks Good In Uniform) Has Entered The Porn Biz, Now She's Sensitive Right Down To The Armpits. Mana Hayshi

  • aina hayashi censoredblowjobbeautiful girlSQTEs cuteSQTE-359SQTE359sqte00359
    • 2021-02-13
    151 min

    [APKH-164]A 149cm-Tall F-Cup Titty Sex Toy Beautiful Girl She's Got A Tiny Body And Beautiful Big Tits And She's Super Horny! When She Gives You A Relentless Titty Fuck You'll Have The Ride Of Your Life On Her Wiggling And Jiggling Tittie

  • rina takase censoredcreampiebig titsAPKHaurora project annexhaurora project anexAPKH-164APKH164apkh00164
    • 2021-02-12
    71 min

    [opsen-017]ひまり

  • amateur censoredbig titsuniformopsenopsen-017opsen017opsen-017
    • 2021-02-12
    145 min

    [IPX-607]Hey, Hey, You Wanna Fuck？ Sucking School Life With A Super Cute Beautiful Y********l In Uniform Amu Amatsuka

  • amatsuka amu censoredsquirtingschoolgirlIPXidea pocketdishIPX-607IPX607ipx00607
    • 2021-02-12
    147 min

    [EBOD-805]It's Been 10 Months Since Her Graduation... A Year Ago She Was A S*****t-Athlete! The National Freestyle Champion! Long-Limbed G-Cup Swimmer Ria Sarashina, Age 18, Makes Her E-BODY Debut!

  • ria sarashina censoredbig titsuniformEBODe bodymon cEBOD-805EBOD805ebod00805
    • 2021-02-11
    189 min

    [DANDY-749]This S********l Came To See Me In The Hospital And She Got Me Hard By Flashing Panty Shot Action At Me And Teased Me With A Blowjob And Made Me Cum And When My Dick Was Super Sensualized She Started Sucking On My Tip And Gave Me A Cleanup

  • censoredschoolgirlblowjobDANDYdandykenkyo momoiroDANDY-749DANDY7491dandy00749
    • 2021-02-11
    93 min

    [OKS-105]Wet And Shiny And Tight A Goddess In A Competitive Swimsuit Urara Kanon Enjoy A Cute Girl In A School Swimsuit To Your Heart's Content! Watch Her Change In Peeping Videos, And Check Out Her Tiny Titties, Big Tits, And Shaved Pussy Fun, T

  • hanaoto urara censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-105OKS1051oks00105
    • 2021-02-11
    124 min

    [FSDSS-169]Stepsisters Yume & Momo's Passionate Sex Life Yume Nikaido Kaname Momojiri

  • nikaido yume kaname momojiri censoredbig titsschoolgirlFSDSSfalenosatoshi maedafaleno starFSDSS-169FSDSS1691fsdss00169
    • 2021-02-11
    93 min

    [OKK-023]Wet And Shiny And Tight A Goddess In A Competitive Swimsuit Runa Tsukino Enjoy A Cute Lolita In A Competitive Swimsuit To Your Heart's Content! Watch Them Change In Peeping Videos, And Check Out Their Tiny Titties, Big Tits, And Shaved P

  • tsukino luna censoredbeautiful girlsingle workOKKdaddy s private photosgodly swimming raceOKK-023OKK0231okk00023
    • 2021-02-10
    71 min

    SWEET-050 Rinori

  • amateur censoredschoolgirlamateursweetsweet-050sweet050sweet-050
    • 2021-02-09
    140 min

    [SDAB-167]I Thought My Stepfather Was A Creepy Bastard, And He Had An Awful Personality, But Now, We Were All Taking A Family Vacation Together ... While Mother Was Nearby, This Man I Hated With A Passion Was Fucking My Brains Out, And Yet, I Found M

  • asai censoredschoolgirlbeautiful girlSDABsod creategoemonone s youthSDAB-167SDAB1671sdab00167
    • 2021-02-09
    52 min

    [ETQR-193](Daydream POV) Raw Creampie Sex With A Barely Legal Beautiful Girl In A School Sailor Uniform. Yui 03

  • censoredcreampieuniformETQRerotic timeETQR-193ETQR193h-1186etqr00193
    • 2021-02-09
    55 min

    [ETQR-194](Daydream POV) Raw Creampie Sex With A Barely Legal Beautiful Girl In A School Sailor Uniform. Miwa 04

  • censoredcreampieuniformETQRerotic timeETQR-194ETQR194h-1186etqr00194
    • 2021-02-08
    54 min

    [ETQR-191](Daydream POV) Raw Creampie Sex With A Barely Legal Beautiful Girl In A School Sailor Uniform. Natsu 01

  • censoredcreampieuniformETQRerotic timeETQR-191ETQR191h-1186etqr00191
    • 2021-02-08
    57 min

    [ETQR-192](Daydream POV) Raw Creampie Sex With A Barely Legal Beautiful Girl In A School Sailor Uniform. Kanna 02

  • censoredcreampieuniformETQRerotic timeETQR-192ETQR192h-1186etqr00192
    • 2021-02-07
    96 min

    345SIMM-605 Good glue, good face, good sensitivity! Secret special training on the bed with spokon J ○ ♪♪ Eat a lot and radiate the replenished energy with etch! !! Uncle sperm injection is completed in the energetic Hatsuratsu beauty Ma ○ Ko who ded

  • amateur censoredcreampieuniformsimmsimm-605simm605345simm-605
    • 2021-02-06
    150 min

    [SSNI-988]They Hooked Up Online - Secret Tryst Between A Slutty S********l And An Older Guy Obsessed With School Uniforms Sayaka Otoshiro

  • otoshiro sayaka censoredschoolgirlbeautiful girlSSNIs1 no 1 stylefamSSNI-988SSNI988ssni00988



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi