yu asakura




FC2ONEZAPODCHRVHMNFSDSSATIDMIDVMILKGMEMSHKDSSNIIPXBBANNACXMIDEJUFESANWANZKBIAUKS

2021-01-09
120 min

[MEYD-644]My Friend's Mother - Ravished By Her Son's Friend, Made To Cum Over And Over... Shuri Yamaguchi

  • yuri yamaguchi censoredcreampiebig titsMEYDtameike gorohirokoji osakiMEYD-644MEYD644meyd00644
    • 2021-01-24
    120 min

    [AGAV-047]This Natural Airhead Lolita Babe Has The Greatest I-Cup Colossal Tits I Oiled Up This Fully Clothed Princess' Titties And Satisfied Myself From All Angles And Now My Life Is Complete Hana Himesaki

  • himesaki hana censoredbig titsblowjobAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-047AGAV047agav00047
    • 2021-01-29
    46 min

    [fan-102]あさか

  • amateur censoredbig titsamateurfanfan-102fan102fan-102
    • 2021-02-02
    31 min

    475SKCK-020 Kaname 2

  • amateur censoredanalamateurskckskck-020skck020475skck-020
    • 2021-02-05
    52 min

    FC2PPV 1658738 [Personal shooting] Appearance Wisdom 29 years old A black-haired celebrity beautiful wife who worked at the airport licks the whole body and makes a large amount of unexpected decachin cum shot! !!

  • amateur uncensoredfc2
    • 2021-02-12
    315 min

    [SUPA-569]首都圏素人女子大生 5

  • censoredamateurblowjobSUPAs kyuu shiroutoSUPA-569SUPA569h-244supa00569
    • 2021-03-03
    35 min

    FC2PPV 1709883 First time limited 1200pt ❤️ Lounge Miss Rikako ❤️ Become a slender whore who listens to anything ❤️ Meat folds entwined ❤️ Many purchase benefits

  • amateur uncensoredfc2
    • 2021-04-03
    136 min

    [PKPD-140]A Pay-For-Play Relationship An 18-Year-Old Who's OK With Creampie Sex A Neat And Clean, Secretly Maso Bitch With Black Hair Marina Saito

  • marina saito censoredcreampieuniformPKPDfuck group and fun friends daydreamersPKPD-140PKPD140pkpd00140
    • 2021-04-09
    23 min

    FC2PPV 1761971 [First cock 2 blowjob excitement & squirting view view] << I can not tell my boyfriend → It is really dangerous if I get caught >> Beautiful looks saffle ❤ While handjob, it collapses into pleasure with amazing blowjob tech

  • amateur uncensoredfc2
    • 2021-04-09
    118 min

    [IPX-638]I Can't Stand My Horny Stepdad... But I'm His Favorite Dish... Ravished Again And Again And Made To Cum Ema Futaba

  • futaba emma censoredschoolgirlbeautiful girlIPXidea pocketdishIPX-638IPX638ipx00638
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-04-30
    240 min

    [HEZ-281]It's Coming Out! The Fluids From Amateur Girls Taste Different Squirting Girls! 14 Girls

  • censoredsquirtingbeautiful girlHEZhot entertainmenthot premium archiveHEZ-281HEZ28159hez00281
    • 2021-05-03
    68 min

    SIRO-4504 [First shot] [Whitening slender beauty] [Die on a big cock] She has a cute face and likes Ochi ○ Chin. When she pierces her wet man who was absorbed in pacifier with a big cock .. AV application on the net → AV experience shooting 1525

  • amateur censoredamateursirosiro-4504siro4504siro-4504
    • 2021-05-05
    39 min

    279UTSU-509 Amamiya-san

  • amateur censoredcreampiemarried womanutsuutsu-509utsu509279utsu-509
    • 2021-05-15
    121 min

    [VENX-039]"Are You Getting Excited By Looking At My Underwear？" A Step Aunt Who Sqeezes Every Drop Of Her Step Nephew's Sperm From Her Freshly Taken Off Panties Eriko Miura

  • miura eriko censoredcreampiebig titsVENXvenusrokusaburo mishimafakecest winntersVENX-039VENX039venx00039
    • 2021-05-20
    122 min

    [IENF-142]Amateur Pick Up Naive College Girl Has Her First Experience At A Brothel For Ladies 2

  • aina hayashi rina takase censoredcreampieamateurIENFienergytiger kosakaiienfIENF-142IENF1421ienf00142
    • 2021-05-20
    62 min

    336KNB-155 A Young Wife Who Is Dissatisfied With The Night Life With Her Husband Appears In AV For Stimulation. Her frustrated body is just inserted and lightly stabbed, and her … hair is disturbed and good, and she leans back and cums many time

  • amateur censoredmarried womanamateurknbknb-155knb155336knb-155
    • 2021-05-23
    112 min

    241GAREA-510 Mei

  • amateur censoredbig titsamateurgareagarea-510garea510241garea-510
    • 2021-06-04
    240 min

    [TSP-443]We Set Up A Hidden Camera! The Lecherous Private Tutor's Trap "Please Delete The Video..."

  • censoredcreampieblowjobTSPtokyo specialmanji groupTSP-443TSP443tsp00443
    • 2021-06-06
    60 min

    318LADY-377 Haruna

  • amateur censoredamateurbeautiful girlladylady-377lady377318lady-377
    • 2021-06-25
    54 min

    FC2PPV 1888157 * Limited to this month 2980⇒980pt ★ Super rare amateur ☆ Beautiful woman with a lascivious face ♥ Meiri-chan with beautiful big tits BODY 22 years old ☆ Bewitching sex appeal rich blowjob is the best ♥ Squirting Iki ♥ Gun thrust like

  • amateur uncensoredfc2
    • 2021-07-17
    83 min

    355OPCYN-173 Misuzu Miyamori Misuzu

  • amateur censoredcreampieamateuropcynopcyn-173opcyn173355opcyn-173
    • 2021-08-05
    92 min

    435MFC-130 [Black Gal With Maximum Erotic Deviation] Black Body Gal With Extraordinary Eroticism And Rich Blowjob Vs Dense Cunnilingus Cum Shot Sex From The Battle! [Shiroto Gonzo ＃ Ranran ＃ 24 Years Old ＃ Freeter Who Can Cum Inside By Default]

  • amateur censoredcreampiebig titsmfcmfc-130mfc130435mfc-130
    • 2021-08-16
    113 min

    FC2PPV 2035855 Complete Appearance ♥ ️ 161/40 Super Slender Fair-Skinned Nude ♥ ️ Neat And Chaste Beautiful Wife Forbidden Ntr Affair Sex ♥ ️ De M Nature Is Exposed In The Shame Play Of The Daytime … ♥ ️ ♥ ️

  • amateur uncensoredfc2
    • 2021-08-23
    106 min

    FC2PPV 2066648 First Shot ♥ ️ Complete Appearance ♥ ️ 164/46 Fair-Skinned Slender Beautiful Girl ♥ ️ Teenage Active Girl With Zero Male Experience Though Cute Like An Idol ○ Student Challenges Loss Of Virginity ♥ ️ The Moment When A Meat Stick Digs I

  • amateur uncensoredfc2
    • 2021-08-26
    72 min

    200GANA-2542 Seriously Nampa, First Shot. 1682 I Found An Older Sister Who Drinks With Me At Shibuya Nampa! Bring It To The Hotel And Reach For The Fascinating Chest … The Expression That Was Stunned By The Constant Pleasure Is Sexy ♪

  • amateur censoredbig titsamateurganagana-2542gana2542200gana-2542
    • 2021-08-26
    73 min

    515BTGL-016 (23)

  • amateur censoredcreampiebig titsbtglbtgl-016btgl016515btgl-016
    • 2021-08-28
    240 min

    [HUSR-242]We"re Going On A Trip, Picking Up Girls And Finding Amateurs On The Street! We Discovered This Korean Beauty In South Korea And Asked Her, "Would You Like To Become A Magazine Model In Japan？" And Took Her Back For Sex! 4 Hours

  • censoredamateurHUSRbig mocalbooker thustleHUSR-242HUSR24257husr00242
    • 2021-09-10
    61 min

    FC2PPV 2184830 * Weekend Limited 6000 ⇒ 3980 ★ First Appearance ☆ Miraculous Thirty Beauty ♥ Former Race Queen ♥ Dense Gonzo With Towako ♥ Uncut Long Take ♥ De M Fully Open Irama ♥ Gachi Raw Vaginal Cum Shot ♥ * Separate There Is An Angle Privilege

  • amateur uncensoredfc2
    • 2021-09-23
    127 min

    [IESM-062]Amu Ohara She"s Lifting Her S&M Ban S&M Suspension, Candle Wax Drippings, And Whippings In A Hardcore Breaking In Session

  • amu ohara censoredcreampiebig titsIESMie nergykiku riniesmIESM-062IESM0621iesm00062
    • 2021-09-25
    239 min

    [NASH-578]The Enthusiastic Sucking Of Fully Mature Older Women: 4 Hours, 40 People

  • censoredbig titsblowjobNASHnadeshikoNASH-578NASH578nash00578
    • 2021-09-28
    71 min

    324SRTD-0246 Cheating Video Shooting To Attract Your Boyfriend! ？？ I Should Have Forgotten The Purpose And I’m Serious! (Moe Hazuki)

  • amateur censoredcreampieamateursrtdsrtd-0246srtd0246324srtd-0246
    • 2021-10-01
    118 min

    FC2PPV 2283182 Until 10/3 (Sun) 980pt [None] A Super-Large Volume Of About 2 Hours With A Set Of 2 Works! !! Naked Close Contact With Udon Life Nozomi & Bloomers ♪ * High Quality Review Benefits Available

  • amateur uncensoredfc2
    • 2021-10-07
    222 min

    [PIYO-126]Lewd Masochist S********l Takes A Stroll. "Hey, Don"t You Usually Swallow Cum？" First Experiences With A 40 Year Old Guy. Friendly S********l Gets A Big Lesson Without Realizing It.

  • censoredsquirtingschoolgirlPIYOhiyokopiero taPIYO-126PIYO1261piyo00126
    • 2021-10-16
    109 min

    390JAC-112 [Molester Desire X Beautiful Breasts E Cup X Continuous Squirting] A Frustrated Married Woman Who Is Delusional Every Day! She Gets On The Ethical-Ignoring Molester Train "Siko Siko TRAIN" That Suddenly Appears There! Gachigachi ●

  • amateur censoredcreampiemarried womanjacjac-112jac112390jac-112
    • 2021-10-23
    240 min

    [BDSR-463]Of Course They Will Get Fucked!？ Creampie Bitch Wife Swap - 14 People, 4 Hours

  • censoredcreampieamateurBDSRbigmorkalbanderas takedabig mocalBDSR-463BDSR46357bdsr00463
    • 2021-10-25
    51 min

    541AKYB-040 Honami (24) [Colleague] [Kansai Girls] [Creampie] (Ryukawa Honami)

  • amateur censoredcreampieamateurakybakyb-040akyb040541akyb-040
    • 2021-11-01
    125 min

    [CLOT-020]Pantyhose Temptation Natsuki Takeuchi

  • natsuki takeuchi censoredcreampiesingle workCLOTplanet plusdirector ocloseCLOT-020CLOT020h-237clot00020
    • 2021-11-11
    65 min

    H4610 ki211111 Azumi Yokobashi 21years old

  • amateur uncensoredh4610
    • 2021-12-05
    63 min

    SIRO-4730 [First Shot] [Kirekawa JD] [Innocent Personality] Discovered A Female JD Who Is Inexperienced But Has An Erotic Blowjob. She Is Surprised At The Big Cock Of The Actor, But When She Does Her Rich Service, She Is Pierced Deep In Her Vagina An

  • amateur censoredamateursirosiro-4730siro4730siro-4730
    • 2021-12-11
    135 min

    [DVAJ-549]Pussy-Pounding Piston Cowgirl Sex To Get Her Cunt Foaming With Bodily Fluids, So She Can Give His Dripping Wet C*ck Another Blowjob, And Another Round Of PToM Sex Into Her Welcoming P*ssy Nonoka Sato

  • is it sato momoka kato censoredcreampieblowjobDVAJalice japanakai suiseiDVAJ-549DVAJ549dvaj00549
    • 2021-12-17
    123 min

    [MIDV-018]Lascivious Nurse Full Body Lip Cleaning Makes My Dick Bug Out And Shoots A Lot.

  • aya matsumoto miu natsume miu harukawa lisa natsume iori censoredlesbianmature womanMIDVmoodyzdragon nishikawamoodyz divaMIDV-018MIDV01848midv00018
    • 2021-12-24
    118 min

    [HMN-094]My Friend"s Mom Is A Sexy Lady Who Is Oozing Sexuality, And I Coincidentally Discovered That She Had Registered Herself As "Michiko" On This Hookup App ... So Immediately, From That Day On, I Made Her My Very Own Convenient Cream

  • sayama love censoredcreampiebig titsHMNhon nakahiroaHMN-094HMN094hmn00094
    • 2021-12-25
    119 min

    [GENM-096]Big Tits Slender Beauty Sakura Tsukishima

  • tsukishima sakura censoredbig titssingle workGENMgenekig 3GENM-096GENM096genm00096
    • 2022-01-01
    160 min

    [LULU-113]"You"re Hesitant Even If We Fuck!？" I Was Rejected By Me First Girlfriend For Being Too Much Of A Cherry Boy, I Wear Glasses And Wasn"t Noticed Before By An Old Friend, A Gal With A Tan Ass, Now She"s My Sex Training Par

  • ranka censoredcreampiesingle workLULUlunaticsvagmanLULU-113LULU113lulu00113
    • 2022-01-01
    139 min

    [MMUS-060]Absolute Panty Shot Action! 3 Devilish Beautiful Girl Babes Who Will Give You Nookie While Continuously Tantalizing And Teasing You

  • satsuki mei white peach censoredMMUSmarrionkijin kasaikcpMMUS-060MMUS060mmus00060
    • 2022-01-05
    38 min

    FC2PPV 2569870 First Facial Cumshot! !! Limited Number! [Uncensored] Adolescent Fcup Tsundere Beautiful Girl … If You Stick To It, You Will Suddenly Change Into A De M Girl Who Keeps Spoiling And The First Vaginal Cum Shot! !! I Didn’t Thin

  • amateur uncensoredfc2
    • 2022-01-11
    73 min

    200GANA-2597 Seriously Nampa, First Shot. 1742 The Black Gal With Burnt Skin On Gotegote Nail! I Don’t Hate It Even If I Touch The Body With The Glue Of Alcohol … A Cute Pant Voice To An Obedient Blowjob … This Gap Is The Real Thrill O

  • amateur censoredamateurganagana-2597gana2597200gana-2597
    • 2022-01-13
    244 min

    [OKX-010]The Divine Aoi Mizutani 244 Minutes 7 Videos 7 Fucks!! From A Competitive Swimsuit To A School Swimsuit, From Bloomers To Glasses And Pantyhose, And Then A Peeping Massage And An Adult Video Interview, You"ll Get To See Our Favorite Aoi

  • aoi mizutani censoredcreampiebukkakeOKXpersonal photography of fathergod actressOKX-010OKX0101okx00010
    • 2022-01-14
    171 min

    [MIFD-193]She Came Here To Lick Men"s Anus! Kansai"s Prestigious Young Lady University S*****t, A Gem Of A Pervert, AV DEBUT! Anka Suzune

  • suzune anka censoredanalcreampieMIFDmoodyzmametaro mamezawamoodyz freshMIFD-193MIFD193mifd00193
    • 2022-01-14
    121 min

    [MIAA-565]The Female Manager Of The Training Camp, Who Has Always Wanted To Be A Manager, Had Her Pussy Blistered By The Pistoning Of The Members Of The Club, And Her Sperm Flowed Backwards.

  • white peach censoredcreampiebeautiful girlMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-565MIAA565miaa00565
    • 2022-01-15
    129 min

    [GMEM-055]A Masochistic Wife With A Huge Ass Awakens To Her Lewd Desires With A Whip Installation And Becomes A Dutch Wife

  • censoredbukkakeGMEMavsbuddha davscollector s goldGMEM-055GMEM055gmem00055
    • 2022-01-15
    114 min

    [MRHP-004]Watching An AV Loudly When The Hot Married Woman With A Big Ass Living Next-door Comes Knocking On The Door To Complain. This Sexually Frustrated Married Woman Gets Excited By My Hard Dick And Ends Up Taking Advantage Of Me For A Cum Load!

  • shinoda yu censoredcreampiesingle workMRHPmisesu no sugao emmanuelleichiro yumisakimarried assMRHP-004MRHP004mrhp00004
    • 2022-01-26
    81 min

    326KSS-005 [Dental Assistant X Mask Is The Strongest! !! ] A Slender Beautiful Girl With Long Black Hair Feels With Uncle’s Sex Tech And Cums Continuously! !!

  • amateur censoredcreampieamateurksskss-005kss005326kss-005
    • 2022-01-27
    108 min

    [CHERD-079]Losing My Virginity To A Hot Family Friend, Intense Sex With A Cream Pie Starring Yuna Kitano

  • yuna kitano censoredcreampiemature womanCHERDcenter villagejiro fukagawahanazono center villageCHERD-079CHERD079h-086cherd00079
    • 2022-01-27
    53 min

    10musume 012722_01 Got Introduced To A Cute Girl Who Loves Sex Ao Konno

  • amateur uncensored10musume



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi