• Log in

  • Sign up
JavKiwi
  • Home
  • Jav Uncensored
  • Jav Censored
  • New Releases
  • Trending
  • actors
  • Tags
  • Random Videos
  • Upload your videos
    • Log in
    • Sign up
  • Home
  • Jav Uncensored
  • Jav Censored
  • New Releases
  • Trending
  • Random
  • amateur

  • anal

  • bdsm

  • big tits

  • blowjob

  • bukkake

  • cosplay

  • creampie

  • cumshot

  • deepthroat

  • handjob

  • hardcore

  • japan

  • lesbian

  • lingerie

  • maid

  • married woman

  • massage

  • milf

  • nurse

  • office

  • outdoor

  • school

  • schoolgirl

  • single work

  • squirt

  • teacher

  • teen

  • uniform

200gana 1950




FC2EBODSHKDNACRGMEMSQTEAPODCJODHODVAWDWAAAVENXAUKSGVHPREDFSDSSMIAAHNDMIDESPRDSSNI

2023-08-26
62 min

200GANA-2906 Seriously Flirty, First Shot. 1950 Picking Up A Lightly Dressed Girl Walking Alone At Night! I Was Surprised To Take Off The Protein Ww Easily With Zero Vigilance! De-class Natural Huge Breasts Appeared! ! She Faints In Agony While Rocki

  • amateur censoredbig titsamateurganagana-2906gana2906200gana-2906
  • 2019-01-10
    69 min

    200GANA-1950 Seriously Nampa, first shot. 1242

  • amateur censoredamateurmature womanganagana-1950gana1950200gana-1950
  • 1



  • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi
    • Legal

    • 18 U.S.C. 2257
    • Contact Us
    • DMCA
    • Useful

    • Sign up
    • Log in
    • FAQ
    • Contact
    • Friends

    • Girls Do Porn
    • GirlsDoPorn
    • DaftSex
    • TayLee Wood
    • WoodmanCastingX
    •