aldn




FC2WAAAHNDHMNWANZPREDDTTGVHFSDSSSSNIMILKCAWDMIDVAMBISANBLKHODVNACXRBDJULBBAN

2020-11-28
61 min

Caribbeancom 112820-001 The Story Of Luxury Spa Lady, Vol.85 Mikuro Komori

  • mikuro komori uncensoredcreampiehandjobcaribbeancom
    • 2020-11-28
    33 min

    [HHKL-073]"I'll Get Pregnant... So You Can't Cum Inside Me Today... But..." It's Her Danger Day, So You Should Absolutely Not Fuck Her, But She's Grabbing Hold Of You, And Her Indecision Is Driving You To Give Her All Of Your

  • eri kuriyama censoredcreampiesisterHHKLhunterkawajirihhh groupHHKL-073HHKL073hhkl00073
    • 2020-12-04
    128 min

    [HODV-21531]"We Just Missed The Last Train Home... Do You Want To Cum Over？" After Missing My Last Train Home, I Ended Up Spending The Night At My Lady Boss' Place, And Since Her Husband Was Away On Business, We Ended Up Committing Adulte

  • ai mukai censoredcreampieslutHODVh m pinugami ryouHODV-21531HODV215315642hodv21531
    • 2020-12-05
    478 min

    [OFJE-287]Moe Amatsuka x S********l Best Uniform 12 Titles 8-Hour Special

  • angel moe censoreduniformbeautiful girlOFJEs1 no 1 styleOFJE-287OFJE287ofje00287
    • 2020-12-14
    43 min

    FC2PPV 1606274 [Personal shooting] “More, more stimulation …” A wife who truly enjoys the extraordinary playing with three other sticks

  • amateur uncensoredfc2
    • 2021-01-01
    240 min

    [MMB-342]Sweaty Wives: 7 Wives Overflowing With Sweat When They Shake Their Big Asses And Hips

  • maria nagai kina shinozaki censoredcreampiebig titsMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-342MMB342mmb00342
    • 2021-01-15
    157 min

    [MBMP-001]Picking Up MILFs! She's A Little Tipsy After A Wine Tasting, But She's Game, "Are You Sure You Want To Fuck A Cougar Like Me？" She's Delighted For The The Offer Of Raw Sex, "Oh I Can Still Get Pregnant," But Sh

  • censoredcreampiemarried womanMBMPprestigembmMBMP-001MBMP001118mbmp00001
    • 2021-01-22
    49 min

    FC2PPV 1655482 [SSS] [First Press Limited 1980] Slender beauty laughing at an outburst desperate man ❤️ Do you want to do it with me？ ❤️ Superb body of model class ❤️ Erotic plump lips ❤️ Extremely narrow pussy ❤️ Massive vaginal cum shot for one wee

  • amateur uncensoredfc2
    • 2021-01-24
    58 min

    299EWDX-343 The wife of a musician has an affair and culture! ？？ When a mature wife makes her lonely, she becomes so erotic.

  • amateur censoredcreampiebig titsewdxewdx-343ewdx343299ewdx-343
    • 2021-02-06
    51 min

    [HHKL-084]I Work At A Super Proper Relaxation Salon, And I Know It's Wrong, But The Truth Is, I'm A Horny Bitch Who Gets Excited When I Look At All The Male Customers. Mizuki Yayoi

  • mizuki yayoi censoredcreampieuniformHHKLhuntermorikihhh groupHHKL-084HHKL084hhkl00084
    • 2021-02-12
    118 min

    [MIMK-084]My Aunt's Pussy Feels Amazing Part 2 - My Step-Aunt's Got The Finest Hole Around - Hana Haruna

  • haruna hana censoredcreampiebig titsMIMKmoodyzkitorune kawaguchimankitsuMIMK-084MIMK084mimk00084
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-03-13
    47 min

    H0930 tk0030 Kiyo Namisaki 32years old

  • amateur uncensoredh0930
    • 2021-03-16
    137 min

    [SDMM-087]Orgasm Bicycle + Mirror For Delivery Girls WIth Nice Asses Only! New Model Of Orgasm Bike Is Designed So The More The Rider Pedals The Faster The Huge Dildo Attached To The Seat Fucks Her! She Cums And Sprays As She Has Her Ass Fucked In Fr

  • censoredsquirtingamateurSDMMsod createdainanamagic mirrorSDMM-087SDMM0871sdmm00087
    • 2021-04-09
    147 min

    [EBOD-816]Reverse Cheating! Ravished By Three Wild Busty Sluts At My Workplace (Nipples, Anal, Cock Teasing) Slut Harem.

  • aika hina nanami hina nanase censoredbig titsslutEBODe bodygoemonEBOD-816EBOD816ebod00816
    • 2021-04-17
    71 min

    355OPCYN-162 Lemon

  • amateur censoredamateurbeautiful girlopcynopcyn-162opcyn162355opcyn-162
    • 2021-05-02
    151 min

    [FCDC-132]Secretary With A Huge Round Ass Turns Out To Be A Slutty Nympho Who Seduces The Office Workers With Her Erect Nipples Kurumi Tamaki

  • tamaki walnut censoredslutsingle workFCDCweekenderFCDC-132FCDC132fcdc00132
    • 2021-05-08
    144 min

    [GMEM-031]ULTRA SWEET Pink Pussy Beautiful High Class Girls Only Exploding Overdrive Orgasms Gorgeous Pussy Shudders And Writhes As It Is Soaked In Tears Ren Usui

  • usui ren censoredbdsmsingle workGMEMavs collector sbaba za babbyavscollector s goldGMEM-031GMEM031gmem00031
    • 2021-05-11
    140 min

    [STARS-384]This College Girl Came Straight Here From Her Morning Classes! Her First Orgasm On Camera - Her Pale White Body's 5 Erogenous Zones Explored To Ecstasy! Mio Mashiro

  • mio mashiro censoredbeautiful girlsingle workSTARSsod createkyoseisod starSTARS-384STARS3841stars00384
    • 2021-05-18
    100 min

    [STARS-375]She Won't Leave Her Futon No Matter What I Do - Once My Stepsister Goes To Bed, She's Down For The Night - No Matter How Many Times I Creampie Her Waiting Pussy! Iori Kogawa

  • iori furukawa censoredcreampiesisterSTARSsod createsoran kobayashisod starSTARS-375STARS3751stars00375
    • 2021-05-20
    125 min

    [296CPDE-048]最強属性 48 桜井千春

  • amateur censoredcreampieamateurcpdecpde-048cpde048296cpde-048
    • 2021-06-19
    76 min

    383REIW-075 Alice

  • amateur censoredamateurbeautiful girlreiwreiw-075reiw075383reiw-075
    • 2021-06-30
    103 min

    435MFC-119 [S-type big butt Shinmama who blames the younger man] Kansai dialect quarter Beautiful mom can not show it to her daughter! Cinderella time from "mother" to "woman" ♪ Sucking a young cock with a nasty tongue out blowjob, sw

  • amateur censoredcreampieamateurmfcmfc-119mfc119435mfc-119
    • 2021-07-03
    124 min

    [KAGP-188]We Seduced These Amateur Girls And Convinced Them To Watch A Masturbation Show 11 All You Have To Do Is Watch! So Would You Please Take A Peek At My Pee Wee？

  • censoredamateurblowjobKAGPkaguyahimept mousouzokuokina tsumadorinoprincess kaguya ptKAGP-188KAGP188kagp00188
    • 2021-07-06
    85 min

    FC2PPV 1907983 A boxed girl living in Minato Ward. She has a frustrated body that can’t forget sex. The aching pussy can not be suppressed … Libido is released to a dedicated ejaculation toy with an unequaled cock.

  • amateur uncensoredfc2
    • 2021-07-06
    32 min

    493NAEN-084 1 liter of tide! ？？ De M college student! ？？ If you poke it, just poke it and the tide will pop out Sensitive Ma ○ Ko and Gonzo Morishita Mirei

  • amateur censoredamateurbeautiful girlnaennaen-084naen084493naen-084
    • 2021-07-09
    134 min

    [DASD-888]Living in Azabu, Minato City. Sex Service with Big-Assed Married Women in a High-Rise Condominium Building. Yu Shinoda .

  • shinoda yu censoredbig titssingle workDASDdasmishima rokusaburoDASD-888DASD888dasd00888
    • 2021-07-10
    64 min

    ION-093 Nami

  • amateur censoredamateurbeautiful girlionion-093ion093ion-093
    • 2021-08-06
    50 min

    H4610 gol206 Natsuki Kuramoto 21years Old

  • amateur uncensoredh4610
    • 2021-08-06
    194 min

    [HJMO-466]The Married Couple"s Challenge! If The Husband Comes 2 Times From Mio Kishima"s Amazing Technique, The Wife Will Be Fucked And Creampied By Another Man!

  • kimishima mio censoredcreampiebig titsHJMOhajime kikakuHJMO-466HJMO466hjmo00466
    • 2021-08-06
    63 min

    SIRO-4574 [First Shot] [Blow Job With A Horny Sound] [Amazing Continuous Iki] An Active JD With A Wonderfully Cute Shy Reaction. The Body On The Verge Of An Outburst That Has Been Overtaken By Masturbation Exposes Continuous Death Many Times .. Appli

  • amateur censoredamateursirosiro-4574siro4574siro-4574
    • 2021-08-20
    118 min

    [JUL-689]Mom Gets Seduced By My Bully, Starring Rin Okae

  • rin okae censoredbig titsmature womanJULmadonnakawaijou osamuJUL-689JUL689jul00689
    • 2021-09-01
    120 min

    [GVH-287]My Stepmom"s Real Sex Education Sakura Tsukishima

  • tsukishima sakura censoredcreampiemomGVHglory questkisakura kabinGVH-287GVH28713gvh00287
    • 2021-09-09
    180 min

    [NHDTB-576]"I Need Your Dick In My Ass And Pussy Please..." Remote Dildo For Long Distance Anal Play Pleasure! Sports Girl Loves Getting Her Two Holes Filled For Maximum Pleasure Down Below!

  • censoredNHDTBnatural highxylonocaineNHDTB-576NHDTB5761nhdtb00576
    • 2021-09-11
    164 min

    [DGCEMD-054]-Digital Exclusive! Free Video Included- I Tried Training A Sex Doll Who Does What I Want Vol. 5 Yui Hatano

  • yui hatano censoredcreampiemature womanDGCEMDcelebrity friendsDGCEMD-054DGCEMD054dgcemd00054
    • 2021-09-17

    FC2PPV 2213482 [Latest Work] Kansai Trip With Erika For 2 Days And 1 Night! Erika-Chan Is Naughty Even During A Date!

  • amateur uncensoredfc2
    • 2021-10-01
    124 min

    [MIDE-978]Nonstop Pleasure, Grinding Sex, And Endless Squirting Orgasms Starring Nao Jinguji

  • jinguji temple nao censoredcreampiebig titsMIDEmoodyzdoragon nishikawamoodyz divaMIDE-978MIDE978mide00978
    • 2021-10-23
    97 min

    FC2PPV 2367108 [Individual Shooting 59] Complete Appearance Prefectural K ③ Super Loli Suji Pie Bread Cleaning Fellatio After Re-Injection Many Times From Continuous Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-10-30
    121 min

    [BKD-271]Stepfamily Fuck [Road To Okushiobara] Hibiki Otsuki

  • otsuki sound censoredcreampiemature womanBKDrubytsuji koujitabijiBKD-271BKD271bkd00271
    • 2021-11-02
    63 min

    [HEYZO-2649]Asaka Sera Deep Kiss, Furious Sex -Entwined Tongues-

  • asaka sera uncensoredcreampiehandjobheyzo
    • 2021-11-12
    101 min

    [VAGU-240]Married Woman Yuri Sasahara Who Loves To Get Spoiled Acts Lovey-Dovey, Gets An Intimate Creampie Bath

  • yuri sasahara censoredcreampiemature womanVAGUvenuskanieultimaVAGU-240VAGU240vagu00240
    • 2021-11-13
    181 min

    [SORA-346]Everything You Want to Do with a Convenient Sex Friend Outdoors. Leona (21 years old)

  • censoredbig titsSORAyama to sorahimu lockSORA-346SORA346sora00346
    • 2021-11-19
    67 min

    SNYZ-045 Rei-chan 2 (Usami Suzu)

  • amateur censoredbig titsamateursnyzsnyz-045snyz045snyz-045
    • 2021-11-19
    110 min

    [VEMA-172]Beautiful Female Teacher"s Girlfriend Is My Class Homeroom Teacher, Club Advisor, And My Lover - Forbidden Passionate Creampie Sex With Older Girlfriend From Morning Till Night - Kana Morisawa

  • kana morisawa kanako iioka censoredcreampiemature womanVEMAvenuskaniemegami venusVEMA-172VEMA172vema00172
    • 2021-12-29
    31 min

    H4610 ki220104 Yuri Kondou 21years old

  • amateur uncensoredh4610
    • 2022-01-04
    86 min

    261ARA-522 [Transcendental Beauty] [Big Tits To Love] Rino-Chan Visits! "If You Feel Comfortable, It Will Be Good For Beauty!" I Want To Have Sex To Keep It Beautiful! !! W [Obscene G Cup] [Nasty Service Tech] With A Tongue That Is Too Erotic

  • amateur censoredbig titsamateuraraara-522ara522261ara-522
    • 2022-01-08
    144 min

    [EKDV-674]This Bitch... She Is In Heat Right Now!？ Wanna Have Sex With Hinako Mori？

  • hinako mori censoredcreampieblowjobEKDVcrystal eizopearl rice sakagamie kissEKDV-674EKDV674ekdv00674
    • 2022-01-11
    73 min

    200GANA-2597 Seriously Nampa, First Shot. 1742 The Black Gal With Burnt Skin On Gotegote Nail! I Don’t Hate It Even If I Touch The Body With The Glue Of Alcohol … A Cute Pant Voice To An Obedient Blowjob … This Gap Is The Real Thrill O

  • amateur censoredamateurganagana-2597gana2597200gana-2597
    • 2022-01-16
    65 min

    SIRO-4761 [First Shot] [Slender Gal] [Sensitive Constitution] Imadoki Gal Who Likes Old Clothes Exposes His Foolery With His First Shot Sex. With The Intense Piston Of Standing Back, I Felt A Lot While Turning Over The Delicate Body .. Application Am

  • amateur censoredamateursirosiro-4761siro4761siro-4761
    • 2022-01-19
    50 min

    FC2PPV 2604126 [Blow 2 Works] A Maid In Akihabara, 19 Years Old & Yokohama Kindergarten Sakura Group Teacher, 25 Years Old.

  • amateur uncensoredfc2
    • 2022-01-28
    45 min

    [544IDJS-052]ゆか (20) 若干ハタチの猛者降臨

  • amateur censoredamateuridjsidjs-052idjs052544idjs-052
    • 2022-01-29
    60 min

    [292MY-531]飯島セリア 1

  • amateur censoredmarried womanamateurmymy-531my531292my-531
    • 2022-02-09
    120 min

    [268SPYE-280]不純異性交遊 セーラー女子校生がパンチラ誘惑で悩殺！ 2

  • amateur censoreduniformschoolgirlspyespye-280spye280268spye-280
    • 2022-02-10
    60 min

    230OREV-007 Yuki (22) (Miyuki Arisaka)

  • amateur censoredcreampiebig titsorevorev-007orev007230orev-007
    • 2022-02-25
    137 min

    [PED-018]They Were Left Alone For Only 7 Hours ... But As A Result, They Fucked 11 Times. Yuri Oshikawa

  • yuri sugawa censoredsingle workPEDdream ticketkurumi ichinosePED-018PED01824ped00018
    • 2022-03-03
    119 min

    [AARM-066]Therapist Has Expert Finger Techniques For Lewd And Delicate Nipple Fondling While Giving An Underhand Oil Handjob, Keeping That Dick Fully Hard The Whole Time.

  • minamishin mai sakiri censoredAARMaroma planningshigeo kadowakiaromaAARM-066AARM066aarm00066



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi