amateur high vision planning censored javcensored




FC2AMBIAUKSONEZSSISPPPDCHRVSQTEDASDMVSDMIAAWAAAHUNTBIPXEBODGMEMMIDEWANZSDABGVHSAN

2021-01-08
136 min

[HODV-21542][Complete POV] Girl Speaking The Ibaraki Dialect - Naoko Akase

  • naoko akase censoredcreampiesingle workHODVh m pHODV-21542HODV215425642hodv21542
    • 2021-01-18
    68 min

    IDJS-029 Yuna

  • amateur censoredcreampieamateuridjsidjs-029idjs029idjs-029
    • 2021-01-22
    241 min

    [AMA-068]A Sexual Genius A Shocking Horny Amateur Test Shoot These Real Amateur Babes Are Here Test The Limits Of Their Sexual Talents For The PRESTIGE Label vol. 68

  • censoredbig titsamateurAMAprestigeamateurAMA-068AMA068118ama00068
    • 2021-02-06
    120 min

    [JUL-459]She's Got Brains And Beauty - Hot MILF Madonna Exclusive Part 3! Your Mom's Friend Mayuka Kitagawa

  • mayuka kitagawa censoredbig titsmature womanJULmadonnajyoji kawaiJUL-459JUL459jul00459
    • 2021-02-12
    148 min

    [SABA-677]Sharing A Hotel Room With My Coworker After We Went Out And Missed The Last Train... She Seemed So Unguarded, I Couldn't Resist Her... vol. 006

  • censoredcreampieuniformSABAskyu shirototodoSABA-677SABA677h-244saba00677
    • 2021-02-18
    73 min

    [REBD-534]Maria 3 - My Time Will Come - Maria Aine

  • maria aine censoredsingle workREBDrebeccatiger kosakaiREBD-534REBD534h-346rebd00534
    • 2021-02-20
    93 min

    300MAAN-626 [Carnivorous gals drown in the pleasures of sake pond meat forest! !! Endless screaming x climax] Flashy hair, flashy face, ass with a bite! Anyway, Imadoki gal who stands out! !! If you have alcohol, it’s all okay ♪ Drink, drink, dr

  • amateur censoredcreampieamateurmaanmaan-626maan626300maan-626
    • 2021-03-07
    54 min

    FC2PPV 1679101 Yuko, an active cosmetologist who has an adult sex appeal ❤️ We are looking for someone who will change into naughty underwear and defeat the sexual desire monster that tempts you together.

  • amateur uncensoredfc2
    • 2021-03-12
    241 min

    [AMA-070]A Sexual Genius A Shocking Horny Amateur Test Shoot These Real Amateur Babes Are Here Test The Limits Of Their Sexual Talents For The PRESTIGE Label vol. 70

  • censoredsquirtingamateurAMAprestigeamateurAMA-070AMA070118ama00070
    • 2021-03-26
    16 min

    10musume 032621_01 Secret Pussy Collection: Kyoko Takagi

  • amateur uncensored10musume
    • 2021-03-29
    53 min

    492JCHA-044 Destroy JK with the first denma 3

  • amateur censoreduniformschoolgirljchajcha-044jcha044492jcha-044
    • 2021-03-30
    244 min

    [311AXDVD-0287R]奴●女 5 悶絶絶頂

  • amateur censoredamateuraxdvdaxdvd-0287raxdvd0287r311axdvd-0287r
    • 2021-04-01
    124 min

    [NACR-414]A Maso Secretive Man And A Sadistic Pantyhose-Wearing Elder Sister Type Yuri Honma

  • really censoredcreampiebig titsNACRplanet plusdirector onanakuruNACR-414NACR414h-237nacr00414
    • 2021-04-07
    98 min

    428SUKE-067 [Iki in the vagina x convulsions x pursuit piston] Only the drunken kiss demon won! !! Choking is inevitable! ？？ H-cup weapons rampage! !! !! Milking, Imara, and lewd on parade! Drunk pie panma that draws threads ● High-speed piston merci

  • amateur censoredcreampiebig titssukesuke-067suke067428suke-067
    • 2021-04-13
    50 min

    FC2PPV 1768376 * Limited time 2980⇒1980pt ★ Amateur wife ☆ Pocha Lori busty wife Marimo-chan re-advents without worrying even if her 23-year-old gets caught by her husband! ☆ Perverted young wife who came to a 3P orgy with sexual desire ♥ Lust for tw

  • amateur uncensoredfc2
    • 2021-04-18
    68 min

    FC2PPV 1775865 [T ● Many appearances] An older sister from the Race Queen unit. Cum 10 barrage

  • amateur uncensoredfc2
    • 2021-04-22
    254 min

    [HMVF-015]FUCK NET LAMPOON 5 A Private Video Session / Amateur Cosplay Edition / 4 Hours / POV / Social Media / Creampie Sex / College GIrl / Idol / Big Tits / Threesomes / Cosplayer / Private Video Session / Secret Account Girl

  • censoredamateurcosplayHMVFhamedori.network secondeditionit s an amateurHMVF-015HMVF015h-1472hmvf00015
    • 2021-05-07
    143 min

    [IPX-652]Cheating On A Work Trip: Hot Female Employee Made To Cum By Her Hung Boss Miu Shiromine

  • shiramine miu censoredblowjobsingle workIPXidea pocketbungo maedadishIPX-652IPX652ipx00652
    • 2021-05-14
    120 min

    [MVSD-464]Beloved Mr. Lizard Raunchy Deep Kissing And Creampie Sex Between A Beautiful Y********l In A School Uniform And Her Middle Age Teacher Nanase Asahina

  • asahina nanase censoredcreampieschoolgirlMVSDm s video groupMVSD-464MVSD464mvsd00464
    • 2021-05-20
    125 min

    [FSDSS-226]Arina, The Slutty Daddy's Girl Who Loves Slightly Masochistic Older Men Arina Hashimoto

  • there is hashimoto censoredsingle workFSDSSfalenomichiru arashiyamafaleno starFSDSS-226FSDSS2261fsdss00226
    • 2021-05-21
    119 min

    [HND-994]Multiple Creampie Brothel Where You Can Fuck The Girls Raw As Much As You Want Hana Himesaki

  • himesaki hana censoredcreampiebig titsHNDhon nakazaku araiHND-994HND994hnd00994
    • 2021-05-27
    157 min

    [fc2-ppv 1837970]【お買い得】緊急事態宣言再延長セール！！3Qから怒涛の3SEX！ FC2-PPV-1837970

  • amateur uncensoredfc2
    • 2021-05-29
    121 min

    [AUKG-511]A Wife And Her Mother-In-Law Became Lesbian Lovers - This Horny Stepmom Fucked Her Daughter-In-Law After Watching Her Prancing Around With Her Guard Down, Flashing Panty Shot Action At Her Alice Otsu Shuri Yamaguchi

  • otsu alice yuri yamaguchi censoredbig titslesbianAUKGu krentoAUKG-511AUKG511aukg00511
    • 2021-06-04
    90 min

    380SQB-104 Rika

  • amateur censoredbig titsamateursqbsqb-104sqb104380sqb-104
    • 2021-06-11
    78 min

    259LUXU-1425 Luxury TV 1416 Former idol slender beauty makes her first AV appearance to fill her loneliness and fulfill her desire to be seen by others! The tense expression swells, and while shaking the beautiful breasts, she writhes with the techni

  • amateur censoredamateurluxuluxu-1425luxu1425259luxu-1425
    • 2021-06-15
    120 min

    [ZEX-405]Hot And Steamy Sex Pure And Innocent Sex Pure Lesbians In A World With Only Beautiful Women OR Dark Crazy Instinctual Sex

  • yuri sugawa satomi yuria censoredbig titslesbianZEXpeters maxZEX-405ZEX405h-720zex00405
    • 2021-06-26
    67 min

    [DANDAN-003]She Can Never Say No! Nurse With H-Cup Tits Devotedly Services Her Patients With Titty Fucking Miss Arioka

  • censoredbig titsblowjobDANDANdandytanaka baconDANDAN-003DANDAN0031dandan00003
    • 2021-07-08
    72 min

    10musume 070821_01 The Structure Of Woman : Examing a Cutie’s Gorgeous Body Hazuki Doumoto

  • amateur uncensored10musume
    • 2021-07-10
    114 min

    [REAL-772]A Sex-Addict's Switch Is Flipped When She Catches A Glimpse Of Her Step-Brother's Confined Cock Rena Aoi

  • blue censoredslutsingle workREALreal workskannana dainanareal real worksREAL-772REAL772real00772
    • 2021-07-16
    71 min

    [YMDS-044]An Uhar Bitch A Spanish Bitch With A Glamorous Body EMILY

  • emily hikari sakuraba censoredbig titsblowjobYMDSmomotaro video publishingdukeyoung peachYMDS-044YMDS044ymds00044
    • 2021-07-17
    75 min

    355OPCYN-170 Rin Miyazaki Rin

  • amateur censoredcreampiemarried womanopcynopcyn-170opcyn170355opcyn-170
    • 2021-07-18
    121 min

    [APNS-249]A Beautiful Lawyer Brought Low - Kanna Hirai

  • shiori hirai censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-249APNS249apns00249
    • 2021-07-27
    240 min

    [RDVHJ-136]These Two Old Ladies Were At An Izakaya Bar, So I Went Over To The Counter And Asked For Some Slut Action, And Instead Of Getting Mad, They Started To Enjoy It, And Let Me Have Raw Fucking Creampies!!

  • ayaka muto kato tsubaki censoredbig titsmarried womanRDVHJgraffiti japanfair estRDVHJ-136RDVHJ13648rdvhj00136
    • 2021-08-26
    107 min

    [GS-400]This Sexy Big Tits Security Guard Discovered A Prowler ... And Disciplined Him So Hard With Her Sexy Body That She Practically Shattered His Ass!! Her Uniform Was Open In The Front, Revealing Her Sexy And Jiggling Big Tits, Luring Him To A Ro

  • censoredbig titsGSsosoru garconreddo bo ruGS-400GS4001gs00400
    • 2021-09-04
    76 min

    FC2PPV 2143507 "God" Young Lady 19-Year-Old Active Beautiful Girl JD Appeared! !! Minimoni 145 Cm! !! 19-Year-Old Active Female College Student, Fair-Skinned Silky Skin Cum Shot To A Super Lady, Complete First Shooting "Personal Shooting&

  • amateur uncensoredfc2
    • 2021-09-04
    140 min

    [KTB-050]Dressed Colossal Tits - The Sexual Councelor Hana"s ( I Cup) Confessions- Hana Himesaki

  • himesaki hana censoredbig titssingle workKTBkahanshin tigers mousozokukahanshin tigersKTB-050KTB050ktb00050
    • 2021-09-10
    91 min

    DCH-012 Shizu (Ichiki Mahiro)

  • amateur censoredcreampieamateurdchdch-012dch012dch-012
    • 2021-09-10
    195 min

    [HUNTB-094]Naughty Sounds Of Knocking Boots At The Library! When A S********l Comes Across Erotica Her Panties Get So Drenched That She"s Down For A Quickie!

  • censoredcreampieschoolgirlHUNTBhunterkawajirihhh groupHUNTB-094HUNTB094huntb00094
    • 2021-09-17
    120 min

    [MIMK-095]Empty Train Station - Live Action Version. Complete 3 Part Compilation. Chapters In The Series Have Sold Over 90,000 Copies. Two Barely Legal Girls Are Taken In And Made To Do It In This Issues Title Made Into A Live Action Film.

  • rina takase misono waka censoredcreampiebig titsMIMKmoodyztakarase hironorimankitsuMIMK-095MIMK095mimk00095
    • 2021-09-17
    123 min

    [TPPN-206]First-time Debut For TEPPAN! Maina Yuri Is A Gal With Big Tits That Gives Into Waves Of Pleasure! Crazy Blowjob BUKKAKE And Wet Messy Sex.

  • yuuri censoredbig titssingle workTPPNteppanTPPN-206TPPN206tppn00206
    • 2021-10-07
    56 min

    1Pondo 100721_001 Please Don’t Take Off Your School Uniform! Rino Sakuragi

  • amateur uncensored1pondo
    • 2021-10-17
    81 min

    230OREC-913 Yua (Rina Kawaei)

  • amateur censoredcreampieamateurorecorec-913orec913230orec-913
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-29
    160 min

    [WAAA-117]Sorry To Keep You! Release of Black World Fuck Megaton Climax of Incontinence and Creampies in Unmatched Big Dick Large Marathon Orgy Kana Yume

  • kana yui censoredcreampiesquirtingWAAAones factorywanzWAAA-117WAAA117waaa00117
    • 2021-11-02
    56 min

    FC2PPV 2301382 [Personal Shooting] Nasty Dirty Big Tits Slender Beautiful Wife Misuzu-San Has A Large Amount Of Raw Vaginal Cum Shot!

  • amateur uncensoredfc2
    • 2021-11-04
    125 min

    [JRZE-084]First Time Filming My Affair, Shoko Yasunaga

  • shoko yasunaga censoredcreampiemature womanJRZEcenter villagemitsusato koutaroushoku ureJRZE-084JRZE084h-086jrze00084
    • 2021-11-13
    120 min

    [AQSH-079]Shoplifting Housewife Since Your Breasts Look So Delicious, Instead Of Reporting You The Perverted Shop Manager Will Just Fuck And Creampie You Without Your Permission Tani Azusa

  • azusa tani censoredcreampiebig titsAQSHaqua mall heroaqua mallAQSH-079AQSH079aqsh00079
    • 2021-11-19
    41 min

    FC2PPV 2446768 [Personal Shooting, Vaginal Cum Shot, 3P, W Privilege, Pt Off For A Limited Time] 37-Year-Old Mature Woman Married Woman’S Mature Beauty, A Lewd Feast To Play With Two Meat Sticks

  • amateur uncensoredfc2
    • 2021-11-19
    300 min

    [DVDMS-736]Finally Allowed To Do A Face Reveal! Magic Mirror Service - All Members Are Over 170cm! 8 Members Total For This Sex Special! Tall Office Ladies With Beautiful Legs That Work At A First-rate Company - Compilation. Shapely Beautiful Legs In

  • censoredamateurDVDMSdeepsfunky haseithe magic mirrorDVDMS-736DVDMS736dvdms00736
    • 2021-12-12
    42 min

    SKHO-020 Nozomi (Nozomi Kazama)

  • amateur censoredcreampieschoolgirlskhoskho-020skho020skho-020
    • 2021-12-20
    180 min

    [NXG-368]An Extraordinary Mature Woman. A Selection Of The Best. Yui Hatano ？ HATANO YUI？

  • yui hatano censoredcreampiesingle workNXGstar paradisenext groupNXG-368NXG368h-254nxg00368
    • 2021-12-23
    150 min

    [MTALL-006]NTR Titties ~ Step Mom Has Her Tits Sucked In Front Of Her Step Son By The Neighbor ~ Sachiko

  • sachiko censoredbig titsmarried womanMTALLmateriallultimate ryoMTALL-006MTALL006
    • 2021-12-24
    118 min

    [ROE-032]On The Eve Of Her Son"s Marriage, The Mother Became A Woman. Yuka Mizuno

  • yuka mizuno censoredmature womanmomROEmadonnaamazing meatmonroeROE-032ROE032roe00032
    • 2021-12-28
    70 min

    OREX-333 Licca-chan 3 (Rika Miama)

  • amateur censoredcreampieschoolgirlorexorex-333orex333orex-333
    • 2022-01-01
    127 min

    [KTKZ-093]"Who Are You？" A Super Beautiful Girl Who Made It The Final Round Of An Idol Group Audition Is Making Her Sensational And Vivid Virgin-Deflowering Debut! Yuka-chan

  • censoredamateurbeautiful girlKTKZkitixx mousouzokushinjinKTKZ-093KTKZ093ktkz00093
    • 2022-01-06
    480 min

    [PPT-120]野々浦暖 8時間 BEST PRESTIGE PREMIUM TREASURE vol.4 全6作品 未公開映像で「野々浦暖」の軌跡をたどる永久保存盤！！

  • amateur censoredamateurpptppt-120ppt120ppt-120



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi