amateur javcensored mature woma big tit housewife




FC2ABWDASDSTARSMVSDHUNTBKSBJAUKGWANZVENUMILKSPRDMIDVSSISHNDMEYDSQTECHRVKBISANCESD

2020-12-25
59 min

[WKD-037]Fallen Woman June Lovejoy

  • june lovejoy censoredslutsingle workWKDwaap entertainmentk westwWKD-037WKD0372wkd00037
    • 2021-01-01
    61 min

    FC2PPV 1627713 [Personal shooting] ♀ 268 Gravure Nono-chan 19 years old SP01 2020 Christmas special edition! A beautiful girl is conceived as a child seed juice gift (laughs)

  • amateur uncensoredfc2
    • 2021-01-13
    50 min

    320MMGH-285 Picking up amateur women at the end of the mirror issue again. Refill SEX voyeur video released without permission. Miu (21)

  • amateur censoredcreampieamateurmmghmmgh-285mmgh285320mmgh-285
    • 2021-01-16
    150 min

    [EKDV-653]Oiled Up Colossal Tits - Slick J-Cup Spread Wide With Ecstasy! Hana Himesaki

  • himesaki hana censoredcreampiebig titsEKDVcrystal eizokumataro morinoe kissEKDV-653EKDV65349ekdv00653
    • 2021-01-16
    67 min

    FC2PPV 1643640 [No / Piece] Small cute drunk OL selfie Gonzo !？ After the secret year-end party of the year, bring seniors to the hotel and super rich vaginal cum shot SEX !! * There is a face-up review privilege

  • amateur uncensoredfc2
    • 2021-01-21
    43 min

    FC2PPV 1654047 [First shot] Imadoki JD ♥♥ who is curious and loves H Pien rushes in a rainy day happening …

  • amateur uncensoredfc2
    • 2021-01-29
    242 min

    [MDBK-156]童顔で身体は超ボイン！！ベビーフェイスでぷるんぷるんオッパイ30人のロ●巨乳BEST240分！！

  • inaba yuuri censoredcreampiebig titsMDBKk m producek taroubazookaMDBK-156MDBK156h-1496mdbk00156
    • 2021-02-05
    104 min

    [SCR-262]Peeping Video: A Female Worker At A Hot Springs Inn's Obscene Video

  • censoredcreampieSCRglay zs crimeSCR-262SCR26212scr00262
    • 2021-02-05
    61 min

    Caribbeancom 020521-001 The Continent Full Of Hot Girls, File.081 Riina Okamoto

  • riina okamoto uncensoredcreampiehandjobcaribbeancom
    • 2021-02-20
    63 min

    200GANA-2440 Seriously Nampa, first shot. 1600 Discovered a beautiful office lady in Ikebukuro! I had them take off their skin to prevent premature ejaculation! ？？ Anyone will explode in the appearance of Bon, Kyu, Bon’s attractive body shape co

  • amateur censoredbig titsamateurganagana-2440gana2440200gana-2440
    • 2021-02-25
    227 min

    [NHDTB-495]A Lesbian Massage Parlor That Will Directly Target Female G-Spots They'll Develop These Undeveloped Bodies Through Nipple Tweaking And Teasing Until They Can No Longer Resist Their Orgasmic Pleasure

  • censoredsquirtinglesbianNHDTBnatural highvanilla sakuraiNHDTB-495NHDTB4951nhdtb00495
    • 2021-02-25
    64 min

    SIRO-4434 [First shot] [Big breasts teacher who is too erotic] [I can’t die with my boyfriend ..] G milk nursery teacher with a sweet face with a strong libido. She turns her guilty feelings towards her boyfriend into a spice of sex and is distu

  • amateur censoredbig titsamateursirosiro-4434siro4434siro-4434
    • 2021-02-27
    241 min

    [FSPT-010]She's Not Even 148cm Tall This Lolita Beautiful Girl Is Tiny But Sexy 7 Girls 240 Minutes

  • censoredbig titsbeautiful girlFSPTfirstpeachteenFSPT-010FSPT010h-491fspt00010
    • 2021-03-06
    209 min

    [HUNBL-035]Irrumatio x Creampie Sex x Bukkake G*******ging Sex This Bitchy Female Employee Is Always Hanging With The Guys And Doesn't Seem To Have An Ounce Of Sexuality, So We Made Her Suck Dick! And Have Creampie Sex! And Then We Bukkake Splatt

  • censoredcreampiedeepthroatHUNBLhuntercognac kaminohhh groupHUNBL-035HUNBL035hunbl00035
    • 2021-03-30
    51 min

    1Pondo 033021_001 Piledriver BJ, Special Edition 15 Yuki Sasaki Anna Kataoka Yuka Sayama

  • amateur uncensored1pondo
    • 2021-04-08
    144 min

    [IESP-679]Asuka Momose - First Time Lesbian - I Fell In Love With My Cousin

  • momose asuka rumi tadami censoredschoolgirllesbianIESPienergykikuriniespIESP-679IESP6791iesp00679
    • 2021-04-14
    119 min

    [OKSN-330]New Discovery! Naturally Tanned Beauty With Incredible Curves! Her Lust Is Off The Charts - She'll Want You To Breed Her Every Chance She Gets

  • censoredbig titsOKSNabc mousouzokuokaasan.com abc daydream familyOKSN-330OKSN330oksn00330
    • 2021-04-17
    154 min

    [HND-972]The Grand Prize Winner Of Her Hometown's Yukata Contest! She Seems Like The Relaxing Type, But Her Body's Super Sensitive! Plus She's A STEM Major At An Ivy？! Her Creampie Porn Debut! Real Life College Girl Miona

  • censoredcreampieHNDhon nakainaballHND-972HND972hnd00972
    • 2021-04-29
    102 min

    428SUKE-069 [Kotteri Mating of Sensitive Mashimashi] Rent a mobile battery and a ramen shop part-time job beauty and Pakopako SP! !! Hot spring → Hotel ladder SEX! Roughly fuck a tight body! Eat the third round of free balls instead of vaginal cum sh

  • amateur censoredcreampieamateursukesuke-069suke069428suke-069
    • 2021-05-06
    76 min

    200GANA-2482 Seriously Nampa, first shot. 1632 I should have just shown a picture of my pet … A slender busty beauty who has been played with her chemo ears before I knew it! There is a pet’s qualities, a figure that hangs down and hangs do

  • amateur censoredbig titsamateurganagana-2482gana2482200gana-2482
    • 2021-05-11
    480 min

    [MUCH-128]Hips Over 40"! Girls With Big Bangin' Booty - Dynamite SEX 10-Girl Compilation, 8 Hours, 2 Discs

  • shizuka ishikawa urara motomura censoredcreampieMUCHmothermuchi mutchiMUCH-128MUCH128h-796much00128
    • 2021-05-17
    60 min

    499NDH-017 [Girl’s bar signboard girl in Shinjuku. ] Big breasts H cup bunny costume clerk who wore fishnet tights with a high degree of etch was persuaded with two champagnes! [Rumor! Tokyo signboard girl. 2nd person]

  • amateur censoredbig titsamateurndhndh-017ndh017499ndh-017
    • 2021-05-28
    121 min

    [MIAA-444]Teaching A Super Impertinent Brat A Lesson By Grabbing Her And Fucking Her Hard Ichika Matsumoto

  • ichika matsumoto censoredcreampiedeepthroatMIAAmoodyzsuisei akaieveryone s porn starMIAA-444MIAA444miaa00444
    • 2021-06-10
    122 min

    [FSDSS-238]On That Very Day, After The Graduation Ceremony ... I Confronted My Female Teacher (Whom I Had Been Secretly Dating) With All Of The Love I Had For Her These Past 3 Years, And Showered Her With Sweet, Loving Kisses And Fucked Her Brains Ou

  • nine yoshitaka censoredsingle workFSDSSfalenoxavier thomas 2faleno starFSDSS-238FSDSS2381fsdss00238
    • 2021-06-19
    124 min

    [URE-068]Minori Hatsune X MILF Comics - Original Work By Zenzen Yamamoto - Oops, I Cheated - Pure, Chaste-Seeming Married Woman Brimming With Secret Lust Brought To Life On Screen!

  • hatsune minori censoredbig titsmature womanUREmadonnadragon nishikawaure.comiURE-068URE068ure00068
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-09
    72 min

    [ion-092]真緒(23)

  • amateur censoredamateurbeautiful girlionion-092ion092ion-092
    • 2021-07-15
    120 min

    [DDHZ-011]A Woman Addicted to Confinement: The Sexually Frigid Biracial Blonde Wife. Karina Nishida.

  • nishida karina censoredbdsmsingle workDDHZdogmanormal kimmy wifeDDHZ-011DDHZ011ddhz00011
    • 2021-07-17
    75 min

    FC2PPV 1927776 G-Cup Girl, Raw Saddle "Personal Shooting" Individual Shooting Completely Original 122nd Person While Enrolled In March At A Famous University

  • amateur uncensoredfc2
    • 2021-07-21
    39 min

    527SROC-015 Mari (21)

  • amateur censoredamateursrocsroc-015sroc015527sroc-015
    • 2021-07-22
    146 min

    [MIDE-953]Middle-Aged Guy who was Fired from a Company Fucks the Company President's Daughter in a Garbage Room for a Whole Week in Summertime of Sweaty Sex. Shoko Takahashi

  • shoko takahashi censoredbig titssingle workMIDEmoodyzlamb chopmoodyz divaMIDE-953MIDE953mide00953
    • 2021-07-22
    124 min

    [WAAA-087]Huge Dick Thrusting Into Tight Cunt!! Raw Fucking Creampie NTR - Rara Kudou

  • lara kudo censoredcreampiesingle workWAAAwanz factorywanzWAAA-087WAAA087waaa00087
    • 2021-07-24
    54 min

    [DANDAN-006]"This Old Lady Can't Wait..." The Sensual Therapist In A Legit Massage Parlor That Invites A Boner. Her Secret Option That Leaves You Breathless. Miss Mina ( 30 Years Old) I Cups.

  • censoredbig titshandjobDANDANdandytanaka baconDANDAN-006DANDAN0061dandan00006
    • 2021-08-21
    131 min

    [CEMD-049]Eye-Watering Non-Stop Hard Cum Fucking 13 Chisato Shoda

  • shota chisato censoredbig titsmature womanCEMDserebu no tomoCEMD-049CEMD049cemd00049
    • 2021-08-31
    105 min

    451HHH-030 AV First Experience [F Cup! ] [Short Stature Gal! ] [Systemic Erogenous Zone] The Appearance And Tone Are The Minimum Gals Of The Saba Saba System! After All, I Like Flirting Sex While Saying Something Like "I Like Sex And I Want Money

  • amateur censoredbig titsamateurhhhhhh-030hhh030451hhh-030
    • 2021-09-10
    118 min

    [JUL-709]My Beloved Stepmom Raised Me By Herself, And Now, She Was Being Fucked By My So-Called Friend ... Yu Shinoda

  • shinoda yu censoredcreampiemature womanJULmadonnashiro shotenJUL-709JUL709jul00709
    • 2021-09-11
    40 min

    362SCOH-068 [Creampie] Let A Carefully Selected Beautiful Girl Cosplay And Conceive My Child! [Ze ● Two 2] Rika Aimi

  • amateur censoredcreampiebig titsscohscoh-068scoh068362scoh-068
    • 2021-10-02
    171 min

    [MMKZ-102]A Cute Face And A Huge Ass!! Yuri Fukada

  • yuri fukada censoredbig titssingle workMMKZmarrionmiyamoto kojirouirisMMKZ-102MMKZ102mmkz00102
    • 2021-10-03
    93 min

    345SIMM-668 [Beautiful Girl With Sensual Nice Ass J ○] Arisu-Chan, An Active School Girl Who Is Dating An Uncle Of An Erotic Doujin Writer, Masturbates Her New Work Drawn By Her Uncle To A Side Dish. Daughter! I Rounded Up My Date Early Today And Wen

  • amateur censoredcreampieuniformsimmsimm-668simm668345simm-668
    • 2021-10-05
    32 min

    FC2PPV 2302408 Until Today! Appearance! "# 4-2" Apparel Clerk In The Neighborhood. "Do You Want To Do It Again？" A Woman Who Does Not Run Out Of Sexual Desire Begs For Vaginal Cum Shot ♡ Both Feelings ♡

  • amateur uncensoredfc2
    • 2021-10-05
    121 min

    [LOL-201]Y********l Specialty. The Cutest Beautiful Girl Stays Over For POV Creampie Fucking. Riho Takahashi

  • riho takahashi censoredcreampiebig titsLOLglayzrori senkaLOL-201LOL20112lol00201
    • 2021-10-22
    159 min

    [CJOD-319]The Convenient Apartment Wife"s Midday Adultery. Countless Creampies Into The Frustrated Big Tits Body. Mina Kitano

  • mina kitano censoredcreampiebig titsCJODbitorendei yamaguchichijo hebunCJOD-319CJOD319cjod00319
    • 2021-10-27
    52 min

    [541AKYB-043]このは(23)【寝起き】【中出し】

  • amateur censoredcreampieamateurakybakyb-043akyb043541akyb-043
    • 2021-11-03
    40 min

    FC2PPV 2398795 [New Work, Half Price! ] ♀ 329 Soap Miss Momo-Chan 24 Years Old 1st Time First Shot! Immediate Scale, Immediate Bed + Super Tech Slimy Mat Play, Raw Vaginal Cum Shot AV Fallen To Conceive A Customer’S Baby To The Finest Soap Lady!

  • amateur uncensoredfc2
    • 2021-11-06
    97 min

    390JAC-106 [Saddle Tide Flood Warning Is Being Issued! !! ] Visit Riko-Chan, A Healthy Slender Gal With A Dazzling Sunburn! !! "I Can’t Help It Because I Want To Spear … ♪" Geki Pis Sex 5 Production That Is Merciless To The Estrus G

  • amateur censoredcreampiesquirtingjacjac-106jac106390jac-106
    • 2021-11-06
    133 min

    [CEMD-078]Anal Temptation Sex Wan Horikita - We Got Our Fill Of Sex With A Girl When Our C*cks Got Excited For Anal Fucking! -

  • horikita wan censoredanalmature womanCEMDserebu no tomoCEMD-078CEMD078cemd00078
    • 2021-11-12
    88 min

    [VENX-091]Remote Play With Son-in-law Visiting Tokyo Once A Month. Going to Play With Him This Month Too. Asaka Tomita.

  • asaka tomita censoredcreampiemature womanVENXvenuskanieincest vi nasuVENX-091VENX091venx00091
    • 2021-11-25
    229 min

    [SUN-037]A Job-Hunting S*****t who Swallows Semen. The College Girl in an Interview Outfit who has an Anime Voice and Exhibitionist Activities where She Swallows.

  • nishina momoka censoredbig titssingle workSUNsunbacon tanakaSUN-037SUN03713sun00037
    • 2022-01-14
    150 min

    [MIDV-030]This Gravure Idol / Office Lady Was Targeted For Shame Because Of Her Marshmallow-Soft Colossal Tits She Hated Her Boss, But When They Were Booked Into The Same Room Together, He Pumped Her With His Big Juicy C*ck And Made Her Cum, Over And

  • dream censoredbig titsblowjobMIDVmoodyzcaptain eharamoodyz divaMIDV-030MIDV030midv00030
    • 2022-01-29
    58 min

    [c0930-hitozuma1372]横山 扶佐子 29歳

  • amateur uncensoredc0930
    • 2022-02-05
    141 min

    [BAVC-008]I"d Like To Finish Off With A Cum Face Load! Fresh Face Teacher Loves To Suck And Lick It All Down While Giving A Blowjob With Cum Dripping On Her Face. Minami Hironaka

  • hironaka minami censoredcreampiesingle workBAVCbaltanyuki mogeravictoriaBAVC-008BAVC008bavc00008
    • 2022-02-09
    72 min

    FC2PPV 2654244 [Minami Aoyama’s Beautiful Breasts Celebrity Wife Re-Advent] Ntr Nasty Wife Kyoka’s Squirting And Acme Can’t Stop The Secret Meeting Affair Sex [Real Amateur]

  • amateur uncensoredfc2
    • 2022-02-14
    65 min

    SIRO-4750 [First Shot] [Husky Voice Girl] [Beautiful Big Tits] An Active College Student Who Has A Slightly Dry Personality But A Sensitive Lewd And Wet Body. She Grabbed A Nice Ass With Outstanding Elasticity And Died Unbearably When She Was Struck

  • amateur censoredbig titsamateursirosiro-4750siro4750siro-4750
    • 2022-02-26
    67 min

    H0930 tk0053 Midori Hongo 29years old

  • amateur uncensoredh0930
    • 2022-03-04
    160 min

    [HUNTB-230]Is This Bullying! No, It"s The Greatest Reward! I"m The Only Guy At My School, And the Female S*****ts Mess Around With Me And Fuck Me A Ton! Last Year It Was A Girls" School...

  • censoredcreampieschoolgirlHUNTBhuntercognac kaminohhh groupHUNTB-230HUNTB230huntb00230
    • 2022-03-11
    151 min

    [DVDMS-789]Not The Best Personality, But A Fucking Great Body. Dominant Female Cabin Attendant With Gorgeous Legs Feeds Me An Aphrodisiac And Takes Me Back to Her Hotel And Uses Me For Sex Over And Over Again. (Reverse Resentment). Hinako Mori.

  • hinako mori censoredcreampieDVDMSdeepsfunky haseideep sDVDMS-789DVDMS789dvdms00789



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi