atid




FC2AMBIHDKANACXMIAANNPJNGODSSNICESDKSBJSANAUKGSDABWAAANATRSQTEMIDVSSISPPPDGMEMCAWD

2020-10-09
89 min

[hstg-012]まい

  • amateur censoredcreampieuniformhstghstg-012hstg012hstg-012
    • 2020-10-11
    97 min

    [VENU-969]My Sister-In-Law Came Onto Me Suddenly, And We Enjoyed A Two Day Trip Of Constant Ecstasy Haruna Kawakita

  • hebei haruna censoredcreampiebig titsVENUvenussarufakecest winntersVENU-969VENU969venu00969
    • 2020-10-11
    118 min

    [AVSA-142]SUPER FISHEYE FETISHISM: Powerful Excitement Honey Photo, Plump Sensual Erotic BODY - Saya Minami

  • minami saya censoredbig titssingle workAVSAavs collector sbuddha davscollector sAVSA-142AVSA142avsa00142
    • 2020-10-16
    68 min

    259LUXU-1332 Luxury TV 1314 A beautiful slender golf instructor has appeared on Luxury TV to remind you of the pleasure of sex that you haven’t tasted for a long time! Exposing the desire hidden inside in front of the camera, adorably devouring

  • amateur censoredamateurluxuluxu-1332luxu1332259luxu-1332
    • 2020-10-24
    117 min

    [NNPJ-408]An Investigative Documentary About A Secret Underground Part-Time Job Super Popular In Ike******! We Nampa Seduced A Big Tits Delivery Health Call Girl With Some Serious Issues Ayase-san (Not Her Real Name) H-Cup Titties A Real-Life Intelle

  • censoredbig titsamateurNNPJnanpa japanno directorNNPJ-408NNPJ408nnpj00408
    • 2020-10-31
    103 min

    300MIUM-642 [Saddle of famous instrument] [Beauty BODY runaway girl] [Killer machine that ejaculates a man] There is no house and I live overnight! Erotic tech that aggressively attacks! Dirty little with a masterpiece of unintentional discharge! !!

  • amateur censoredamateurmiummium-642mium642300mium-642
    • 2020-11-06
    190 min

    [HUNBL-019]My Little Stepsister Always Ignores Me But Keeps Up A Front With My Friends, So I Hit Her With Some Irrumatio And Fucked Both Her Holes, Top To Bottom, In A Threesome Creampie Fuck Fest

  • censoredcreampiesisterHUNBLhuntermasanorihhh groupHUNBL-019HUNBL019hunbl00019
    • 2020-11-06
    78 min

    259LUXU-1324 Luxury TV 1323 A beautiful tutor with adorable looks and overwhelming presence of G-cup big tits appears again! Show off masturbation with a gentle but unwilling hand … The body lit by masturbation reacts sensitively just by caressi

  • amateur censoredbig titsamateurluxuluxu-1324luxu1324259luxu-1324
    • 2020-11-22
    103 min

    [OAE-202]Premonition Of Dangerous Love Shoko Takahashi

  • shoko takahashi censoredsingle workOAEaircontrolOAE-202OAE202oae00202
    • 2020-11-23
    238 min

    [CEAD-325]Totally Freshly Filmed! A Voluptuous Elder Sister Type With An Erotic Ass Is Wearing Tight Black Pantyhose While Having Sex 2

  • aishin shinkawa natsuki censoredcreampiemature womanCEADceleb no tomoCEAD-325CEAD325cead00325
    • 2020-12-06
    31 min

    FC2PPV 1596600 [Face exposure] Mother of two big breasts. In the room where you are sleeping with your child, you are conceived by being vaginal cum shot many times with two strange sticks in the back of the vagina

  • amateur uncensoredfc2
    • 2020-12-08
    59 min

    FC2PPV 1594320 [Beautiful Breasts Gloss] Mai Beautiful Big Breasts GET! Sneak into a nearby condominium and blame a toy for a throbbing blowjob sensitive pussy on the emergency stairs “Creampie piece ♪” [with bonus]

  • amateur uncensoredfc2
    • 2020-12-28
    44 min

    FC2PPV 1623202 [Personal shooting] All I want to satisfy is sexual desire … A stick of others prepared to satisfy the desires of a 38-year-old married woman ②

  • amateur uncensoredfc2
    • 2021-01-15
    63 min

    300NTK-501 Reiwa No.1 Miss Kyaba Advent! !! If you insert a beautiful girl who is serving customers nowadays with a raw chin …! !! Slender beauty body shakes and warps Keiren continuous ascension! !! Echiechi sexual intercourse recording video o

  • nosex censoredcreampieamateurntkntk-501ntk501300ntk-501
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-25
    52 min

    FC2PPV 1659353 [First cock 2 simultaneous blowjob ❤ complete appearance] Fcup big breasts girl reappears ☆ Masturbation while blowjob handjob w Oil slimy massage & shrimp shaving with finger man torture Dirty beauty big tits Tayun Tayun! With Ful

  • amateur uncensoredfc2
    • 2021-01-30
    56 min

    C0930 ki210131 Mai Katagiri 26years old

  • amateur uncensoredc0930
    • 2021-01-30
    64 min

    SIRO-4411 [First shot] [Supreme style] [Sensitive premature ejaculation ○ ko] A perfect beauty salesperson with the best face, body, and sensitivity. If you grab Yanagi’s waist and pierce the big cock, you will bounce your waist many times and r

  • amateur censoredbig titsamateursirosiro-4411siro4411siro-4411
    • 2021-02-12
    67 min

    FC2PPV 1683739 [First Press Limited 1980] [SSS] Ginza’s beautiful hostess I met for the first time in half a year ❤️ Did you train in the pillow business？ ？？ Echi Echi degree heat up ❤️ I have awakened to Succubus ❤️ * There is a review privileg

  • amateur uncensoredfc2
    • 2021-02-19
    131 min

    [BIJN-194]The Document - Instinctive, Orgasmic Sex Caught On Camera - Screaming, Swooning Orgasms, Beautiful BODY - Extreme Climaxes Hazuki Wakamiya

  • wakamiya censoredbig titssquirtingBIJNbijin majo emmanuelleBIJN-194BIJN194bijn00194
    • 2021-02-19
    123 min

    [BKD-257]Stepmom/Stepson (The Road To Western Nikko) Nao Nakano

  • nanao nakano censoredcreampiemature womanBKDrubyshakojijourneyBKD-257BKD257bkd00257
    • 2021-02-20
    99 min

    [VNDS-3360]The Beautiful Married Woman Masturbation Viewing Society VNDS-3360 3360

  • yasuko ogata hitomi kojima censoredamateurmature womanVNDSstarnextVNDS-3360VNDS3360h-254vnds03360
    • 2021-02-20
    51 min

    491TKWA-158 The talented J ○ who is studying in the library shifts the pants and exposes the pussy and presses for SEX! Of course, without refusing, the last is vaginal cum shot!

  • amateur censoredcreampieuniformtkwatkwa-158tkwa158491tkwa-158
    • 2021-02-27
    66 min

    H4610 ki210227 Rrquest

  • amateur uncensoredh4610
    • 2021-03-03
    120 min

    [PFES-015]Lying In Wait Sweaty At-Home Lessons The Vulnerable Personal Trainer Risa Hasegawa

  • risa hasegawa censoredbig titssingle workPFESdaschinpo dazaisummer panties festivalPFES-015PFES015pfes00015
    • 2021-03-04
    184 min

    [SHIND-003]A Relentless Pervert Rides The Maso Train Home Invasion Record #5 6

  • censoredamateurSHINDshinkirousuzuki o maSHIND-003SHIND003h-1560shind00003
    • 2021-03-06
    198 min

    [HUNTA-957]For One Price, You Can Fuck Anyone, For As Much As You Like! As Long As You Pay The Flat Monthly Rate, You Can Stick Your Dick Into Any Of the Female S*****ts Or Even The Female Teacher! Episode 0 0

  • censoredschoolgirlblowjobHUNTAhunterkorosukehhh groupHUNTA-957HUNTA957hunta00957
    • 2021-03-06
    71 min

    FC2PPV 1714892 [Personal shooting] ♀ 301LJ series ◯ -chan 18 years old 1st time The day after graduation, the world’s full appearance is conceived and vaginal cum shot AV debut and life ends at 18 years old!

  • amateur uncensoredfc2
    • 2021-03-11
    98 min

    [XMOM-029]My Husband Hasn't Had Sex With Me In Six Months... I'm So Horny That I Brought The Guys From My Walking Club Back Home To Fuck While He's At Work Nozomi Haneda

  • nozomi haneda censoredcreampiemarried womanXMOMcenter villagemurakipink breathXMOM-029XMOM029h-086xmom00029
    • 2021-03-13
    240 min

    [MIDE-900]182 Furious Orgasms! 3714 Pussy Spasms! 13478cc Of Serious Pussy Juice! An Abstention Teasing Orgasm Massive Awakening Special!! - After Storing Up All Of Her Lust For 30 Days, She Let It All Out In One Explosive Day - Nozomi Ishihara

  • ishihara hope censoredbeautiful girlMIDEmoody smichiru arashiyamamoodyz divaMIDE-900MIDE900mide00900
    • 2021-03-13
    126 min

    [CEAD-332]I'm A Horny Masturbationist And I've Gone Crazy For Pleasure 12 Himari Kinoshita

  • himari kinoshita himari hanazawa censoredmature womansingle workCEADceleb no tomoCEAD-332CEAD332cead00332
    • 2021-03-24
    30 min

    494SIKA-067 [For Mania] Bukkake 3P with a barely popping daughter

  • amateur censoredamateurbukkakesikasika-067sika067494sika-067
    • 2021-03-30
    55 min

    292MY-435 Yumina Ogura

  • amateur censoredbig titsmarried womanmymy-435my435292my-435
    • 2021-04-23
    145 min

    [MIDE-915]Hot Cum Dumpster (Shoko) Obedient, Easy, Pretty Slut Will Come To A Love Hotel For Sex Whenever You Want Her Shoko Takahashi

  • shoko takahashi censoredbig titsblowjobMIDEmoodyzmametaro mamezawamoodyz divaMIDE-915MIDE915mide00915
    • 2021-05-08
    107 min

    428SUKE-070 [Miss Yariman x W Chi ● Co x Creampie Superior] SaRi-chan ★ Super brilliant orgy sex with a total of 6 ejaculations! Live dance of Miss Show Club → Sex rush w 3P constantly inserts Ji ● Ko! Use as many big tits and ass as you like www [YO

  • sari censoredcreampiebig titssukesuke-070suke070428suke-070
    • 2021-05-21

    FC2PPV 1830248 Weekend Limited [Uncensored] Creampie at a busty apparel clerk and an internet cafe

  • amateur uncensoredfc2
    • 2021-06-07
    56 min

    FC2PPV 1857725 [3480 → Limited number 2480] 20-year-old concafe beauty with anime voice ❤️ Gestures are very cute ❤️ Girls K students No panties No bra sailor suit forbidden Saddle shooting ❤️ Rich mass cum shot with raw insertion ❤️

  • amateur uncensoredfc2
    • 2021-06-29
    58 min

    H0930 ki210629 Mao Touyama 32years old

  • amateur uncensoredh0930
    • 2021-07-15
    120 min

    [CMC-258]A Widow with Colossal Tits and Fleshy Buttocks: A Record Book of Incidents Involving Brainwashing Stings. Riko Tokushima.

  • riko tokushima censoredsingle workCMCcinemagicshinichi kawamuracollectCMC-258CMC258cmc00258
    • 2021-08-26
    125 min

    [HBAD-593]I Am Weak-willed, I Can"t Refuse... A Compliant Wife With Colossal J-cup Tits And A Soft Body - Hana Himesaki

  • himesaki hana censoredbig titssingle workHBADhibinorokutanzono seishibabeHBAD-593HBAD5931hbad00593
    • 2021-08-26
    119 min

    [DLDSS-024]Celebrity Wife Downfall NTR A Record Of A Former Rich Married Woman Who Started Working At A Convenience Store And Was Fucked By Creepy Store Manager Who Made Her Cum Tina Nanami

  • nanami tina censoredsingle workdramaDLDSSdahliatake dDLDSS-024DLDSS0241dldss00024
    • 2021-09-17
    73 min

    230OREC-880 Maika

  • amateur censoredcreampieamateurorecorec-880orec880230orec-880
    • 2021-09-17
    58 min

    Caribbeancom 091721-001 Personal Trainer Seduces Hot Slim Athlete Anri Kizuki

  • anri kizuki uncensoredcreampiecaribbeancom
    • 2021-09-18
    50 min

    H0930 ori1612 Sayaka Matsuura 27years Old

  • amateur uncensoredh0930
    • 2021-10-07
    135 min

    [SDMU-968]さらば青春の光 森田哲矢 制作総指揮 ペンション殺人事件

  • kawamura yui censoredsoloworkdramaSDMUsod createeasy matsumotosoft on demandSDMU-968SDMU968
    • 2021-10-21
    72 min

    10musume 102121_01 Massuse Scammer Persuades The Innocent Girl To Have Sex That Sex Is An Outstanding Effect For Losing Weight Mei Nozomi

  • amateur uncensored10musume
    • 2021-10-21
    71 min

    FC2PPV 2362961 After All There Was! ] There Are Too Many Erotic Married Women! Frustrated Busty Married Woman Of A Part-Time Job And Erotic Employee’s Horny Estrus Orgy Creampie Party Sex [Relentless Raw Saddle Creampie]

  • amateur uncensoredfc2
    • 2021-10-23
    120 min

    [BLOR-180]An Office Lady With A Soothing Smile And Charming Laugh. A Big Curvy Ass And Sensitive Touch. She Goes Wild For A Huge Dick That Pleasures Her Like Crazy.

  • censoredBLORburokkori mousou zokubroccoliburokkoriBLOR-180BLOR180blor00180
    • 2021-11-13
    129 min

    [MKON-067]"The Next Time We Meet, Let"s Have Our First Kiss" And That"s The Promise I Made With My Innocent Girlfriend, Yoooo LOL But Then She Joined A Fuck Club And I Heard She Got Her Spirit Crushed Wan Horikita

  • horikita wan censoredcreampiesingle workMKONkaguya hime pt mousozokuyumesaki ichiroumikonMKON-067MKON067mkon00067
    • 2021-11-25
    130 min

    [STARS-465]20年ぶりに再会した元カレと狂ったようにハメまくった三日間 佐田茉莉子

  • sada mariko censoreddramaSTARSsod createhiromichi miyaseSTARS-465STARS465
    • 2021-11-26
    139 min

    [IBW-850]My Wife"s Tanned Half-Japanese Daughter Is Just My Type Ran Height: 145cm Ran Sakita

  • sakita ran censoredbeautiful girlIBWi b worksIBW-850IBW850
    • 2021-11-27
    165 min

    [JUKF-073]My Big Brother Is My Masturbation Fantasy Mitsuki-Chan Nagisa Mitsuki

  • scooping censoredcreampieschoolgirlJUKFjumpjump avJUKF-073JUKF073h-227jukf00073
    • 2021-12-07
    58 min

    494SIKA-129 Aphrodisiac Sex At A Hotel Drinking Party

  • amateur censoredamateurbukkakesikasika-129sika129494sika-129
    • 2021-12-10
    477 min

    [OFJE-340]Mai Shiomi"s First Best S1 Debut 1st Anniversary Latest 10 Titles 8 Hours Special

  • mai shiomi censoredbeautiful girlsingle workOFJEs1 no 1 styleOFJE-340OFJE340ofje00340
    • 2021-12-17
    130 min

    [BLK-541]Until Morning, Suck Down As Much As You Want and Fuck as Much As You Want! Discovery of a Junior Mama-san at a Bar. She is a Slut with Totally Erotic Areolas. MIYABI

  • miyabi censoredcreampiebig titsBLKkira kirakira kira black galBLK-541BLK541blk00541
    • 2021-12-17
    149 min

    [EBOD-875]No.1 In The Fudor Popularity Ranking For Three Consecutive Months! Legendary Soap Girl With Big Tits And Big Buttocks Who Serves Customers In Yoshiwara In Summer And Overseas In Winter Makes Her AV Debut! Reiran Akame

  • red eye raylan censoredbig titssingle workEBODe bodyzaku araiEBOD-875EBOD875ebod00875



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi