big tits beautiful girl jav creampie subjectivity




FC2CESDMEYDSANAVSADTTCAWDSQTEDASDBLKNATRPPPDGVHAUKGSDABCHRVHMNMARAPREDMIDEHODV

2020-12-13
126 min

[HNM-010]Aya... As A Sole Submissive Girl The Girl Who Wanted To Give Up Complete Control Aya Shiomi

  • aya shiomi censoredbdsmsingle workHNMavs collector susubashisuiblack mariaHNM-010HNM010hnm00010
    • 2020-12-15
    58 min

    Caribbeancom 121520-001 The sex addict business woman who is having sex everyday right after work Aira

  • aira uncensoredcreampiehandjobcaribbeancom
    • 2020-12-25
    183 min

    [ABW-038]Nothing But Raw Fucking - Endless Creampie Sex. 21 Loads In Her Pussy. Non Nonoura

  • nonoura warm censoredcreampiesquirtingABWprestigeshimikkiabsolutely wonderfulABW-038ABW038118abw00038
    • 2020-12-26
    104 min

    [MIMK-080]"Sorry, We've Sold Out" For Six Months Until The Comics Convention, I've Continued To Engage In Testicle-Draining Sex So That I Could Draw This Erotic Comic Original Story By TDTK A Hit Fan Fiction Manga About Young People O

  • inaba censoredbig titsblowjobMIMKmoodyzbungo maedamankitsuMIMK-080MIMK080mimk00080
    • 2021-01-11
    116 min

    460SPCY-012 [20 years old Akita Prefecture] Moe

  • amateur censoredcreampiebig titsspcyspcy-012spcy012460spcy-012
    • 2021-01-29
    85 min

    [fan-099]かおる

  • amateur censoredamateurblowjobfanfan-099fan099fan-099
    • 2021-01-31
    131 min

    [EMBZ-219](Now Recruiting - Amateur Interviews) A Voluptuous MILF With Colossal Tits Showed Up At Our Company, So We Asked Her If She'd Like To Star In Porn - And She Did! Misato Mitsuki

  • misato mizuki censoredbig titsmature womanEMBZjukujojuku emmanuellejukujo jukuEMBZ-219EMBZ219embz00219
    • 2021-02-03
    61 min

    [ion-075]玲(21)

  • amateur censoredcreampiesquirtingionion-075ion075ion-075
    • 2021-02-06
    110 min

    [LLAN-002]A College Girl. And I'm A Virgin. How It Feels For The First Time... How Does It Feel To Be Rocked By These Emotions For The First Time... I Think, That I Prefer Women... June Lovejoy Mikuni Akane

  • june lovejoy mikuni zhu censoredlesbianLLANvivianlilianLLAN-002LLAN002llan00002
    • 2021-02-12
    120 min

    [EBOD-801]It Took One Whole Year To Persuade Her To Do Porn - The No. 1-Ranked Soapland Hooker In Kanazawa - Real Life H-Cup Brothel Babe's Porn Debut Noa Mochizuki

  • mochizuki censoredbig titsblowjobEBODe bodymon cEBOD-801EBOD801ebod00801
    • 2021-02-15
    82 min

    FC2PPV 1671916 [Club Gal GET] SEX is a sport ★ Attack the plump erotic ass of a Paris clown gal with the back! !! Gonzo with a Dirty Little Gal who enjoys the sexual desire accumulated by going out restrictions and the pleasure after a long absence w

  • amateur uncensoredfc2
    • 2021-02-17
    54 min

    [sika-044]16番みーちゃん 2(18)

  • amateur censoredcreampieuniformsikasika-044sika044sika-044
    • 2021-02-19
    96 min

    [SUJI-129]Selfish S*****t Chiharu Is Men's Desire

  • censoredcreampiebeautiful girlSUJIkanranshaSUJI-129SUJI129suji00129
    • 2021-03-02
    87 min

    261ARA-478 [Extremely erotic BODY if you take it off] 24 years old [Miracle G cup beauty big breasts] This is coming! The reason for her application that she will appear on AV on the way home from work is “Masturbation is not enough …”

  • amateur censoredbig titsamateuraraara-478ara478261ara-478
    • 2021-03-05
    37 min

    [BTH-123]My Cold Cruel Wife Is A Slutty Animal Renowned For Taking Orders Chiharu Nakai

  • chiharu nakai censoredmarried womanBTHchobitchchovicBTH-123BTH123h-1435bth00123
    • 2021-03-07
    129 min

    [PKPD-133]Adulterous Document OF A Masochistic Young Wife WIth Colossal H-cup Tits - Miku Maina

  • maina miku censoredbig titssingle workPKPDfuck group and fun friends daydreamersPKPD-133PKPD133pkpd00133
    • 2021-03-27
    105 min

    [VENX-021]"Do Old Lady Panties Excite You？ Older Woman Milks Young Man Of All Of His Cum With Her Worn Panties Sakura Tsukishima

  • tsukishima sakura censoredcreampiebig titsVENXvenussarufakecest winntersVENX-021VENX021venx00021
    • 2021-04-14
    130 min

    [GVH-222]Trip With My Big Titty Teacher! Exciting Two Night Three Day School Trip To The Hot Springs Miina Wakazuki

  • miina wakatsuki censoredbig titssingle workGVHglory questhyonGVH-222GVH22213gvh00222
    • 2021-04-16
    48 min

    FC2PPV 1743369 [Personal shooting] Masami 34 years old Noble PTA system Dirty little amateur slender wife shoots a large amount of raw squirrel

  • amateur uncensoredfc2
    • 2021-04-19
    20 min

    FC2PPV 1777111 2800pt → 1200pt [Individual shooting, 3P second half] Seriously covered with pregnancy juice without any help to the violently rampaging meat stick! Two strange sticks are inserted many times that the husband has never done, and finall

  • amateur uncensoredfc2
    • 2021-04-24
    120 min

    [KSBJ-133]Adultery At Home Without Her Husband Knowing - Nozomi Azuma

  • nozomi higashi censoredblowjobmature womanKSBJksb kikaku emmanuellebito sakuraKSBJ-133KSBJ133ksbj00133
    • 2021-05-01
    187 min

    [NKKD-205]Married Woman Gets Nailed In A Pubic Bathroom While On A Drive With Her Family! 6 Toilet Cheating

  • censoredmature womanNKKDjet eizomanji groupNKKD-205NKKD205nkkd00205
    • 2021-05-08
    108 min

    [MOPG-069]It'd Be Great If She Was The Kind Of Nasty Slut Who'd Choke Me While Teasing My Nipples. Rian Isaki

  • rian isagi censoredanalslutMOPGm o paradisemo goldMOPG-069MOPG069mopg00069
    • 2021-05-31
    107 min

    241GAREA-516 Non

  • amateur censoredamateurbeautiful girlgareagarea-516garea516241garea-516
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-23
    48 min

    FC2PPV 1884567 [Individual shooting] Metropolitan brass band ② In addition, vaginal back whole body convulsions sex All-you-can-eat at the hotel from morning to evening

  • amateur uncensoredfc2
    • 2021-07-03
    57 min

    C0930 ki210704 Maho Shibata 20years old

  • amateur uncensoredc0930
    • 2021-07-08
    221 min

    [SW-785]Husband And Wife Swapping! "I Want You To Furiously Fuck Me With Your Rock Hard Cock And Make Me Cum While My Husband Watches!" This Horny Housewife Is A Perverted Bitch Who Likes To Cum While Getting Pumped By Another Man's Cock

  • censoredbig titsSWswitchyocchanswitch hibinoSW-785SW7851sw00785
    • 2021-07-14
    118 min

    [ARM-997]Swelling Peeping, Relentless Pussy Appreciation

  • aino rei sena asami honda satomi censoredARMaroma planninghamu oujiaromaARM-997ARM997arm00997
    • 2021-07-31
    151 min

    [KTB-049]The Fresh OL Club! Ichika Ichika Matsumoto

  • ichika matsumoto censoredschoolgirlsingle workKTBkahanshin tigers mousozokukahanshin tigersKTB-049KTB049ktb00049
    • 2021-08-14
    120 min

    [AQSH-074]Firing The Husband Who"s Happy Because He Bought A Home! The Subordinate"s Wife Who Was Creampied Even Though She Asked Him Not To Because She"s On A Dangerous Day. Miho Tono

  • miho tsuno censoredcreampiemature womanAQSHaqua mall heroaqua mallAQSH-074AQSH074aqsh00074
    • 2021-08-24
    57 min

    FC2PPV 2070058 First Shot! Amateur Among Amateurs. If You Get Tired Of Av, You Have To See This! !!

  • amateur uncensoredfc2
    • 2021-09-03
    185 min

    [MIDE-964]I Can"t Resist My Boss"s Titty Temptations And Our Work Trip Turns Into A Fuck Trip. Shoko Takahashi

  • shoko takahashi censoredbig titsslutMIDEmoodyzbiba gonzomoodyz divaMIDE-964MIDE964mide00964
    • 2021-10-06
    102 min

    546EROF-001 [First Outflow] Ab ○ Ma Series Love Reality Show Blue ● Miss Con Beauty Private Gonzo Video (Mitsuki Nagisa)

  • amateur censoredcreampieamateureroferof-001erof001546erof-001
    • 2021-11-05
    232 min

    [TSP-448]Entrapped In Part-time Job. Girl Aiming To Be Craftsman "Shakes Her Pudding-Like Tits and Butt In Front of Me. How Can I Work？!"

  • censoredcreampieblowjobTSPtoukyou supesharugroupTSP-448TSP448tsp00448
    • 2021-11-13
    129 min

    [MKON-067]"The Next Time We Meet, Let"s Have Our First Kiss" And That"s The Promise I Made With My Innocent Girlfriend, Yoooo LOL But Then She Joined A Fuck Club And I Heard She Got Her Spirit Crushed Wan Horikita

  • horikita wan censoredcreampiesingle workMKONkaguya hime pt mousozokuyumesaki ichiroumikonMKON-067MKON067mkon00067
    • 2021-11-20
    130 min

    [MGMQ-084]M-sexual Clinic With Genius S-Lascivious Nurse Who Treats The Anus Of Every Man In The Hospital Mao Hamasaki

  • hamazaki mao censoredanalslutMGMQmegamithe beautiful goddess queenMGMQ-084MGMQ084mgmq00084
    • 2021-11-26
    231 min

    [SKMJ-229]Happy Endings Are Against The Rules At This Men"s Massage Parlor, But After 3 Months This Gorgeous Slut Is Willing To Make Exceptions For Loyal Customers - Her Secret Raw Creampie Sex Options Filmed On Hidden Cameras 2

  • censoredcreampieamateurSKMJred face girlSKMJ-229SKMJ229h-1324skmj00229
    • 2021-12-03
    121 min

    [JJDA-024]A Kind And Gentle Big Tits Wife Is Letting A Hard-Working Fully Erect Cherry Boy S*****t Fuck Her Behind Her Husband"s Back Nene Tanaka

  • nene tanaka censoredcreampiebig titsJJDAjukujo daigaku jukujo manjigroupJJDA-024JJDA024jjda00024
    • 2021-12-04
    119 min

    [XVSR-626]Sex Filming Yui Hatano in Private!

  • yui hatano censoredcreampiebeautiful girlXVSRmax ayoshida ikuzoucalenXVSR-626XVSR626xvsr00626
    • 2022-01-01
    120 min

    390JAC-126 [New Year’s First Delusion! Brush Down A Rough Virgin → Do Professional Actor Super Hamme! !! ] "There Was A Lewd Woman Who Said She Wanted To Eat A Virgin Because She Was Worried About Her Tech." "Silence And Vaginal Cum

  • amateur censoredcreampiebig titsjacjac-126jac126390jac-126
    • 2022-01-06
    60 min

    Pacopacomama 010622_587 The Trick For A Housewife, 27: Married Women Who Goes Nuts Nono Otsuki

  • amateur uncensoredpacopacomama
    • 2022-01-21
    160 min

    [MDTE-022]The Beautiful Shaved Pussy Bitch Gal. Creampie Mating. Riria.

  • censoredcreampieblowjobMDTEuchu kikakutetMDTE-022MDTE022mdte00022
    • 2022-01-27
    121 min

    [FSDSS-351]Each Thursday When My Wife Is Out Late For Lessons, I Enjoy Non-stop Cumming During Close And Passionate French Kissing Sex With My Employee Arina. Arina Hashimoto

  • there is hashimoto censoreddramaFSDSSfalenoyasujiro shidofaleno starFSDSS-351FSDSS3511fsdss00351
    • 2022-01-27
    125 min

    [SDMU-973]中毒的卑猥ボディ 声優志望の乳デカ学生と一日中ずっと生ハメ性交 のん20歳

  • kohana non censoredslutSDMUsod creategoemonSDMU-973SDMU973
    • 2022-01-27
    52 min

    292MY-520 Namiko Hiraoka 2

  • amateur censoredmarried womanamateurmymy-520my520292my-520
    • 2022-01-29
    45 min

    [h0930-ki220130]酒井 恵美 26歳

  • amateur uncensoredh0930
    • 2022-01-29
    100 min

    [SQTE-401]With Her Lolita Pussy, Ichika Comes At Once From Finger-Fucking, And She Has An Orgasm From A Big Vibrator. Ichika Nagano.

  • ichika nagano censoredblowjobbeautiful girlSQTEs cuteSQTE-401SQTE401sqte00401
    • 2022-02-01
    44 min

    [YMDS-073]Platinum Body Beautiful Woman Dances With Pleasure Through Non-stop Orgasms. Explosive Cluster! Must-see SSS Class Beautiful Woman For A Reverse POV! Timid MAYU

  • censoredblowjobslutYMDSmomotaro video publishingdukeYMDS-073YMDS073ymds00073
    • 2022-02-05
    240 min

    [NASH-653]"Sex Medicine." My Father-In-Law, Whom I Had Trusted, Fucked Me.

  • hikari yoshizawa uno sakina abe sakina censoredNASHnadeshikoNASH-653NASH653nash00653
    • 2022-03-08
    66 min

    H0930 ki220308 Yasuko Arakawa 28years old

  • amateur uncensoredh0930
    • 2022-03-24
    18 min

    FC2PPV 2751317 [Uncut Chi-Kas Series] [Uncut Chi-Kas Face-To-Face → Chi-Kas Licking → Chinpo Polishing → Back Streak Ejaculation] Pien Pien And Chi-Kas Licking Jito Eye Eros. 11th ① Cum [Sho-Chan] Blow Specialization

  • amateur uncensoredfc2
    • 2022-03-25
    78 min

    383NMCH-003 Ferratec God Level. Tongue Pi Gal And Icharab Video Leaked

  • amateur censoredcreampieamateurnmchnmch-003nmch003383nmch-003
    • 2022-04-01
    150 min

    WAAA-152 Cherry Boy Sex That Will Envelop You Gently In Her H-Cup Titties And Guide You To Orgasmic Pleasure Ai Sayama

  • sayama love censoredcreampiebig titsWAAAones factorywanzWAAA-152WAAA152waaa00152
    • 2022-04-05
    100 min

    FC2PPV 2776112 Uniform-Chan Who Was In A Pinch Due To The Corona. A Large Amount Of Adult Sperm Is Semen In An Inexperienced Unprocessed Pussy!

  • amateur uncensoredfc2
    • 2022-04-08
    120 min

    JUL-920 I Was Raised By My Beloved Stepsister, And She Was Stolen Away By My Worst Friend...Nao Jinguji

  • jinguji temple nao censoredcreampiemarried womanJULmadonnaascension shiroJUL-920JUL920jul00920



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi