big tits cunnilingus censored javcensored jav




FC2ATIDIPXHZGDSHKDSSNIGVHHNDSQTEMIDVMEYDSDABHUNTBAWDJUFEAVSAHDKAMIAABBANCJODPRED

2020-10-13
38 min

FC2PPV 1532811 First shot ❤️ Complete appearance ❤️ 18 years old ❤️ Fair-skinned beauty body ❤️ Idol class beautiful girl ❤️ I have vaginal cum shot to Ayano-chan

  • amateur uncensoredfc2
    • 2020-10-24
    146 min

    [DASD-752]The Domain Of Her Holy Golden Waters This Beautiful Secretary Received Breaking In Pissing Training From Her Critical President And Now She's Dripping Piss Down Her Marshmallow-Soft Skin And Thighs. Rika Tsubaki

  • tsubaki rika censoredbeautiful girlsingle workDASDdasgoemonDASD-752DASD752dasd00752
    • 2020-10-26
    72 min

    FC2PPV 1547869 [Large amount of facial cum shot from back vaginal cum shot] It is a secret that the voice as if it came up from the pool was cute in the large amount of the juice that was applied to the face in the second shot and entered the third r

  • amateur uncensoredfc2
    • 2020-11-18
    134 min

    [GVH-151]A Beautiful Teacher Who Fell Into The Trap Of Her Bad Boy S*****ts Natsuki Takeuchi

  • natsuki takeuchi censoredsingle workGVHglory questhajime kimuraGVH-151GVH15113gvh00151
    • 2020-12-12
    34 min

    FC2PPV 1604023 Limited [Individual shooting] Prefectural Art Department ③ A girl with short black hair gets fucked for her mother and sister after school

  • amateur uncensoredfc2
    • 2020-12-15
    181 min

    [SDMM-080]The Tables Are Being Turned In This Mid-Summer Edition Of The Magic Mirror Number Bus "Would You Like To See These Amateur Girls At The Beach In Their Bikinis Have Sex In The Raw？" A Seduction Special Featuring Beautiful Girls With

  • censoredbig titsSDMMsod createakira saijomagic mirrorSDMM-080SDMM0801sdmm00080
    • 2020-12-17
    149 min

    [BLK-479]Women So Rude And Crude It's Disgusting We Discovered This Crazy Voluptuous Bitch In A Back Alley Of Maruyamacho And Took Her To A Love Hotel Where We Spent The Entire Day Having A Raw Fucking Creampies Harlem

  • censoredcreampiebig titsBLKkira kirakira kira black galBLK-479BLK479blk00479
    • 2020-12-21
    45 min

    FC2PPV 1592280 [Limited quantity 2400pt → 1200pt] Realistic GoPro video and iPhone high-quality vertical video ❤️ Immediate scale with clothes knit dress ❤️ Slender beauty Constricted Sarah beauty BOBY ❤️ Purchase privilege available

  • amateur uncensoredfc2
    • 2020-12-31
    120 min

    [NKKD-190]This Couple Dreamed Of Living In The Country... The Husband Never Imagined Hung Farmers Would Be Plowing His Wife Miho Tono

  • miho tsuno censoredmature womansingle workNKKDjet eizomanji groupNKKD-190NKKD190nkkd00190
    • 2021-01-15
    73 min

    FC2PPV 1641176 ＃ 50 Hinata Boyish and big breasts. Soft and trained energetic girl and messy creampie sex [Personal shooting] [Gonzo] [High quality]

  • amateur uncensoredfc2
    • 2021-01-23
    136 min

    [CAWD-164]Working Overtime With My Legs Open... Bred By My Boss... Moko Sakura

  • sakura moko censoredcreampiesingle workCAWDkawaiihiroyuki kimuraCAWD-164CAWD164cawd00164
    • 2021-01-24
    178 min

    [CESD-968]Nene Tanaka's Colossal Tits & Big Booty Bounce For Cowgirl Sex 4

  • nene tanaka censoredbig titsmature womanCESDceleb no tomoCESD-968CESD968cesd00968
    • 2021-01-26
    53 min

    FC2PPV 1660371 ★ First shot amateur ☆ Intense big ass ♥ Gonzo with a sexy married woman Naomi 31 years old ☆ Powerful SEX like a foreigner ♥ Rolling up lust for other sticks ♥ Plenty of vaginal cum shot at the end ♥ [Personal shooting] * With benefit

  • amateur uncensoredfc2
    • 2021-01-28
    61 min

    [SIROR-047]Rent-A-MILF - The Secret Sidegig Their Husbands Don't Know About File No. 47 -

  • censoredcreampiebig titsSIRORdispatched.comSIROR-047SIROR047h-1492siror00047
    • 2021-01-30
    120 min

    [WAAA-029]Intently Raw Creampie With A Housewife Dripping In Pheromones! Affair Fucking with Riho Fujimori

  • riho fujimori censoredcreampiebig titsWAAAwanz factorywanzWAAA-029WAAA029waaa00029
    • 2021-02-03
    63 min

    FC2PPV 1670495 [Personal shooting / set sale] I bought a 30-year-old married woman who had been bred. Complete version

  • amateur uncensoredfc2
    • 2021-02-13
    139 min

    [CESD-977]Married Amateur's First Anal Fuck! Iori's First-Ever Two-Hole Fuck In Her Forties Drives Her Wild With Ecstasy!

  • censoredamateurmature womanCESDcelebrity friendsCESD-977CESD977cesd00977
    • 2021-02-26
    60 min

    FC2PPV 1703250 * Immediate deletion available ★ First shot premier beautiful girl ☆ Finally came! Real entertainer ♥ Beauty BODY Kaede 22 years old ☆ Small breasts ♥ Beauty waist ♥ Prickets ♥ Excited about the first vaginal cum shot ♥ [Personal shoot

  • amateur uncensoredfc2
    • 2021-03-19
    119 min

    [BKD-259]Stepmother/Stepson Fucking (The Black Forest Road) Ayaka Muto

  • ayaka muto censoredmature womansingle workBKDrubykoji tsujitobijiBKD-259BKD259bkd00259
    • 2021-03-22
    60 min

    345SIMM-624 Not an affair! This is … [LOVE Sports]! Mediation of Virgin Kun to an experienced Yariman married woman! Dirty words, fucking, spider cowgirl, etc …! 60 minutes 4 games without intervals!

  • amateur censoredcreampiebig titssimmsimm-624simm624345simm-624
    • 2021-03-25
    75 min

    326KNTR-001 Cuckold NN Bulletin! Assault ww by a couple who came out of a love hotel Pregnancy juice explosion ww on a lewd body that is watched by a perverted boyfriend and goes crazy with another stick

  • amateur censoredcreampieamateurkntrkntr-001kntr001326kntr-001
    • 2021-04-15
    240 min

    [OKAX-724]Field Guide To Married Blowjobs - 54 Wives, 4 Hours - Their Tongue Techniques Feel So Good You'll Blow Your Load Right Inside Their Mouths

  • censoredmarried womanblowjobOKAXkm produceferrino urayaside dishesOKAX-724OKAX724okax00724
    • 2021-04-17
    50 min

    Pacopacomama 041721_461 Compliant housekeeper Karin Morishita

  • amateur uncensoredpacopacomama
    • 2021-04-18
    245 min

    [AVSA-165]Breaking In The Queen's Masochistic Men: 4 Hours BEST vol. 2

  • rino kirishima reiko sawamura honami takasaka masumi takasaka censoredbdsmAVSAavs collector smariannuavscollector sAVSA-165AVSA165avsa00165
    • 2021-04-24
    152 min

    [JUKF-060]This College Girl Did As She Was Told By Her Parents And Went On To College In Tokyo And Found Herself Getting Involved With A Dating App, Casually, Like Getting A Part-Time Job (And Going For Some Sugar Daddies) Mao-chan Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsJUKFjumpjump avJUKF-060JUKF060h-227jukf00060
    • 2021-04-30
    240 min

    [HEZ-281]It's Coming Out! The Fluids From Amateur Girls Taste Different Squirting Girls! 14 Girls

  • censoredsquirtingbeautiful girlHEZhot entertainmenthot premium archiveHEZ-281HEZ28159hez00281
    • 2021-05-20
    58 min

    229SCUTE-1116 Mikako (23) S-Cute Creampie in a shaved girl who makes H with a smile

  • amateur censoredcreampieamateurscutescute-1116scute1116229scute-1116
    • 2021-05-20
    121 min

    [FSDSS-231]For The Ultimate Masturbation Complete POV I Will Provide The Best Ever Masturbation Support Yui Shirasaka

  • yui shirasaka censoredblowjobcosplayFSDSSfalenokei isoifaleno starFSDSS-231FSDSS2311fsdss00231
    • 2021-06-25
    102 min

    [YSN-551]My Father-In-Law's A Stud And I'm A Nympho: We Bang Around The Clock Yuri Honma

  • really censoredcreampiebig titsYSNnonYSN-551YSN551h-127ysn00551
    • 2021-07-02
    62 min

    FC2PPV 1899662 [Personal shooting] 65th shooting ¥ Idol ¥ [Amateur video]

  • amateur uncensoredfc2
    • 2021-07-03
    47 min

    C0930 hitozuma1358 Yuika Yoshikata 26years old

  • amateur uncensoredc0930
    • 2021-07-28
    65 min

    ION-094 Reiko

  • amateur censoredcreampiebig titsionion-094ion094ion-094
    • 2021-08-03
    55 min

    326HGP-025 De M Special Material That Cums While Apologizing ☆ Creampie To A Perverted Student Who Pants Alive By Convulsing An Extraordinary De Sensitive Body Many Times! !!

  • amateur censoredcreampiebig titshgphgp-025hgp025326hgp-025
    • 2021-08-21
    88 min

    [AGMX-087]Cowgirl Blowjob And Cum Face

  • aoi kururugi chiharu miyazawa censoredblowjobbeautiful girlAGMXsex agentyuuki mogeraAGMX-087AGMX087agmx00087
    • 2021-08-24
    145 min

    [STARS-432]Too-crazy Nipple Licking - Mariko Sada, 42 Years Old

  • mariko sada censoredmature womanslutSTARSsod createk westsod starSTARS-432STARS4321stars00432
    • 2021-08-28
    158 min

    [JUKF-067]My Older Stepbrother Is My Spank Bank Material - Nonoka - Nonoka Sato

  • is it sato censoredcreampieschoolgirlJUKFjumpjump avJUKF-067JUKF067h-227jukf00067
    • 2021-09-17
    122 min

    [EBOD-855]"Hey Mister, Can We Do It Today Too？" 10-Year Reunion With Fully Mature Step-niece. 1 Month Of Lusting For Rocket-shaped Colossal Tits In Hot Sweaty Summer House. Riho Takahashi

  • riho takahashi censoredbig titsuniformEBODe bodyarashiyama michiruEBOD-855EBOD855ebod00855
    • 2021-09-23
    129 min

    [MOND-221]With My Lovely Senior Satomi Suzuki

  • satomi suzuki censoredmature womansingle workMONDtakara eizouhotate ikkandaiichi housouMOND-221MOND22118mond00221
    • 2021-09-24
    170 min

    [BANK-054]The Creampie Outdoor Bath A Lusty Elder Sister Type With A Slim Body And H-Cup Rocket Tits And Rock Hard Nipples

  • censoredcreampiebig titsBANKma ko ginkoutakechanBANK-054BANK054h-1495bank00054
    • 2021-09-25
    240 min

    [OKAX-775]"I Never Could Have Imagined That I Would Be Fucking My Stepson ..." A Video Record Of What Happened When A Stepmother Invited Her Stepson To Go On A Trip And Gave Him An Erotically Good Time And Fucked His Brains Out 4 Hours

  • censoredmature womanmomOKAXk m producedick mandokuokazuOKAX-775OKAX775okax00775
    • 2021-10-17
    59 min

    200GANA-2580 In The Spear Room Of The Nampa Master Of 100 Battles, Bring In Sex Secret Shooting 222 Re-Drink On The Way Home After Drinking! Beautiful Big Tits & Nice Ass Unfussy Girls Brought Home! Outstanding Proportions That Are Cramped Even Th

  • amateur censoredbig titsamateurganagana-2580gana2580200gana-2580
    • 2021-11-05
    123 min

    [JUL-766]Repeatedly Cumming From The Uncontrollable Embrace Of My Son"s Friend... Kana Mito

  • kana mito censoredmature womansingle workJULmadonnanikusonJUL-766JUL766jul00766
    • 2021-11-06
    111 min

    [CMF-065]Woman Begs For Humbling Treatment at Gyno Clinic With Many Requests. Madoka Mizuno

  • madoka mizuno censoredsingle workCMFcinemagicdirty kudouninfuCMF-065CMF065cmf00065
    • 2021-11-08
    39 min

    362SCOH-054 [Creampie] Let A Carefully Selected Beautiful Girl Cosplay And Conceive My Child! [Te ● Fa] Sara Kagami

  • amateur censoredcreampieamateurscohscoh-054scoh054362scoh-054
    • 2021-11-12
    235 min

    [ACZD-006]Breaking The Anal Upper Limit Yui Misaki

  • yui misaki kansai month ramii censoredanallesbianACZDsanwa shuppanabnormal.companiesACZD-006ACZD006h-019aczd00006
    • 2021-11-19
    64 min

    328HMDN-428 [Emergency Visit To Japan Big Ass French Wife] Haste 3P Cheating The Week After The Newly Married! Saddle Rolled From Front To Back, Covered With Alcohol, Covered With Sperm, 4 Consecutive Conceived Vaginal Cum Shot ♪ (June Lovejoy)

  • amateur censoredcreampiemarried womanhmdnhmdn-428hmdn428328hmdn-428
    • 2021-11-23
    51 min

    FC2PPV 2457158 The Uncle’s Popular [Cosmetology Beauty Salon Receptionist] Was Persuaded By The Elderly Four Times And Went Into The Car On A Rainy Day. I’M Stunned By The Dopply Oral Ejaculation …

  • amateur uncensoredfc2
    • 2021-11-26
    23 min

    FC2PPV 2466412 Last 100! "# 15" Apparel Clerk. She Is A Black-Haired Gal Who Is Quietly Panting And Tightening. Hold The Pillow For The Pleasure Of Raw Insertion ♡ Yes Piece ♡

  • amateur uncensoredfc2
    • 2021-11-29
    97 min

    [EMST-005]紗里 2

  • amateur censoredEMSTsodEMST-005EMST005
    • 2021-12-10
    154 min

    [DASD-945]Cuckolded By Dispatch Massage Therapist Who Touched Sensitive Parts So Much That I Could Not Stand The Pleasure. Maron Natsuki

  • marin natsuki censoredbig titssingle workDASDdasrokusaburo mishimaDASD-945DASD945dasd00945
    • 2021-12-17
    120 min

    [EBOD-879]とにかく明るい彼女のお姉さんの 博多弁ささやき淫語とノーブラ巨乳のW誘惑に負け 彼女のそばで浮気中出しを我慢できない僕 天晴乃愛

  • ai tenharu censoredcreampiebig titsEBODe bodyichigoharaEBOD-879EBOD879ebod00879
    • 2021-12-25
    119 min

    [HMNF-076]Sex Films 07

  • shiina eru iori nanase censoredbig titsblowjobHMNFhmjmcompany matsuonon fictionHMNF-076HMNF076h-172hmnf00076
    • 2022-01-11
    107 min

    [KTRA-366]Niece And Step-Uncle. Hinano"s Record. Hinano Tachibana.

  • tachibana hinano censoredcreampiesoloworkKTRAk tribeutamaroKTRA-366KTRA366
    • 2022-01-21
    96 min

    [VENX-108]I Can"t Live Without My Son Anymore... A Mother Climaxes 80 Times In An Erotic Extreme Trance Nakadashi Kana Morisawa

  • kana morisawa kanako iioka censoredcreampiemature womanVENXvenuspeterfakecest winntersVENX-108VENX108venx00108
    • 2022-01-22
    240 min

    [UMSO-433]Gorgeous House Cleaner Puts Aside Her Work And Seduces The Man Of The House By Masturbating In Front Of Him 15 Women

  • otsuki sound shiina sky censoredcreampieUMSOk m produceumanamiUMSO-433UMSO433umso00433
    • 2022-02-05
    153 min

    [QRDA-140]Anal Clinic The Perverted Female Doctors Are In And Their Asshole Patients Can Never Check Out

  • reiko tsujigami censoredanalQRDAqueen roadkui nro doQRDA-140QRDA140qrda00140



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi