big tits shame censored javcensored




FC2MEYDKBISHKDMILKMIAADASDWAAAMVSDPREDDTTVENUSSISROYDNGODNNPJWANZMIDVSQTEEBODCHRV

2020-10-10
129 min

[MEYD-625]Ultra Famous Porn Star Fucks Her Lover And Takes His Creampie - Over And Above The Normal Adultery Yumi Kazama

  • kazama yumi censoredbig titsblowjobMEYDtameike goroMEYD-625MEYD625meyd00625
    • 2020-10-13
    140 min

    [SDJS-090]Our Blowjob-Loving New Hire Will Drain Your Balls Dry With Her Incredible Cock-Sucking SK**ls - SOD's New Female Employee: Kotoha Nakayama

  • kotoba nakayama censoredamateurblowjobSDJSsod createkomatsu 17sod female employeeSDJS-090SDJS0901sdjs00090
    • 2020-10-30
    58 min

    FC2PPV 1552312 [No / Amateur Individual Shooting] Secretly shoot Miss Deriheru who is good at blaming with sex appeal! The words you speak are exciting! I almost fell in love with it. After negotiations, please enjoy the whole story of the delivery h

  • amateur uncensoredfc2
    • 2020-10-31
    37 min

    FC2PPV 1553513 [Limited quantity 1580pt] ☆ First shot ☆ Fair-skinned marshmallow body ♥ Kincho-like and mature but naughty beauty and vaginal cum shot SEX ♥ [With benefits]

  • amateur uncensoredfc2
    • 2020-10-31
    46 min

    C0930 ki201101 Masae Funakoshi 48years old

  • amateur uncensoredc0930
    • 2020-11-07
    240 min

    [YLWN-142]Cuckold SEX, Married Woman Wild Fuck

  • censoredYLWNyellow moonpappan tateishiYLWN-142YLWN142ylwn00142
    • 2020-11-12
    51 min

    Pacopacomama 111220_383 Seira Oguro, Akiko Kajimura, Akiko Hara

  • seira oguro akiko kajimura uncensoredbig titsfetishpacopacomama
    • 2020-11-13
    94 min

    SMUK-030 Kurumi 2

  • amateur censoredschoolgirlamateursmuksmuk-030smuk030smuk-030
    • 2020-11-19
    126 min

    [MOPT-001]This Long Legged Older Girl Loves Teasing Masochistic Guys. Pantyhose, Jeans, And Knee High Boots... Oh My! Kanon Nakajo

  • nakajo cano censoredslutMOPTm man paradisemo tightMOPT-001MOPT001mopt00001
    • 2020-11-20
    481 min

    [MBM-240]Sadness News Of My Life My Wife Is With Another Man... (Tears) Is Your Wife Okay？ Endless Stream Of Semen Not From Her Husband...Cheating Sex And Unheard Of Nightmarish Creampie Pregnancy 50 Girls 8 Hours

  • censoredcreampieamateurMBMprestigegaro sasazukambmMBM-240MBM240118mbm00240
    • 2020-11-24
    64 min

    SIRO-4327 [First shot] [Transformation of a neat beauty] [Daze climax] The frustrated editor is a generalized erogenous zone. The soft touch makes the body flutter, and it is so crazy that it is stunned with a meat stick for the first time in 3 years

  • amateur censoredamateursirosiro-4327siro4327siro-4327
    • 2020-11-27
    59 min

    [MNSE-002](For Streaming Editions Only) A College Girl From A Famous University Is Working A Creampie POV Part-Time Job Ena

  • censoredcreampiebig titsMNSEcrystal picturemaniac plusMNSE-002MNSE00249mnse00002
    • 2020-11-28
    155 min

    [MMND-192]"Can't Do AV" 99 Cm H-Cup A Quiet Looking Incredibly Slutty And Silent Big Tits Glasses Girl Age 19 Nenne Ui

  • first love censoredbig titssingle workMMNDmimanyuki iwasawaMMND-192MMND192mmnd00192
    • 2020-11-29
    240 min

    [SOAV-071]A Married Woman's Faithless Heart Best Collection 4

  • kanako maeda yui no hikari censoredbig titsSOAVhitozuma engokai emmanuelleihyo kairoiSOAV-071SOAV071soav00071
    • 2020-12-01
    94 min

    FC2PPV 1575406 [Yariman model] Emi [Individual shooting] Bring slender nice ass who came in for model recruitment to the room and defeat it and cum inside! Panchira Peace (Onikawa) Ahegao Piece (Geki Erotic) Creampie [With warehousing bonus]

  • amateur uncensoredfc2
    • 2020-12-15
    136 min

    [KIRE-019]"A Woman's Beauty Comes From Her Booty." Gorgeous MILF In Her Forties With A Fine Ass Shows It Off With Sports Cosplay SEX 3 Mariko Sata

  • mariko sada censoredcosplaysingle workKIREsod createsiberia sakaibeauty kirei sodKIRE-019KIRE0191kire00019
    • 2020-12-27
    62 min

    413INST-082 [Amateur 3P individual shooting] E-cup beauty busty teacher and 3P individual shooting Photo session at La ○ live costume → Massive vaginal cum shot ♀ complete appearance publicly released by college students at the hotel until fainting [

  • amateur censoredcreampiebig titsinstinst-082inst082413inst-082
    • 2021-01-08
    166 min

    [HAWA-234]Adultery Inspection "I Want To Leave Behind Naked Pictures Of Me Being Beautiful" She Was Taking These Memorial Photos For Her Husband, But This Horny Wife Ended Up Being More Into The Young Model's Cock - She's Wet For Him,

  • censoredcreampieHAWAcosmos eizomountain forestcosmospictures soft on demandHAWA-234HAWA2341hawa00234
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-29
    237 min

    [OKAX-698]Home Invasion: Married Woman Gets Ravished 4 Hours

  • censoredamateurmature womanOKAXk m producedick mandokuokazuOKAX-698OKAX69884okax00698
    • 2021-02-01
    244 min

    [ZMAR-035]The Works! Mari Takasugi

  • mari takasugi censoredcreampiesingle workZMARplanet plusthe whole damn thingZMAR-035ZMAR035h-237zmar00035
    • 2021-02-05
    60 min

    [PARATHD-3115]Sugar Baby (2) - Prim, Pretty Office Girl (Age 25) Does Anal

  • censoredamateurblowjobPARATHDparadise tvPARATHD-3115PARATHD3115parathd03115
    • 2021-02-07
    191 min

    [DNJR-043]All-Nude Urethra Teasing

  • aoi kururugi tojo censoredbig titsslutDNJRdog daydreamersmeat and piss house prime cutDNJR-043DNJR043dnjr00043
    • 2021-02-25
    58 min

    H4610 ki210225 Miyuki Takizawa 21years old

  • amateur uncensoredh4610
    • 2021-02-28
    160 min

    [LULU-059]My Dad Got Remarried To A Black-Ass Gal, And While He's Away On Business, She Makes Me Fuck And Creampie Her With My Big Dick! - Ranka

  • ranka censoredcreampiesingle workLULUlunaticsluminaxLULU-059LULU059lulu00059
    • 2021-03-10
    52 min

    FC2PPV 1719387 [Personal shooting] ♀ 302LJ series Yu ◯ -chan 18 years old 1st time first shot! A natural G-cup Lori busty girl who is mistaken for J © gets pregnant at the same time as graduating with a dangerous day cum shot! ？？ (LOL)

  • amateur uncensoredfc2
    • 2021-03-19
    59 min

    [315ETQR-209]【妄想主観】麗しの美人OLと濃密性交 Tsumugi

  • amateur censoredcreampieuniformetqretqr-209etqr209315etqr-209
    • 2021-03-21
    149 min

    [HND-966]Her Husband Can't Cum, So This Married Woman Nailed A Bachelor Who'd Be Piling His Seed Up For 30 Days - Married Slut Gets Bred And Loves It Hikari

  • censoredcreampiebig titsHNDhon nakausa pyonHND-966HND966hnd00966
    • 2021-04-01
    49 min

    10musume 040121_01 Perverted easy girl who became a hyper groovy Kumi Tsukino

  • amateur uncensored10musume
    • 2021-04-08
    128 min

    [IENF-135]This Elder Sister Type Provides Men With A Business Trip Massage, But She Hasn't Met Anyone Good In Years, And Now She's Super Horny And Down To Fuck! When She Touches Men's Bodies, It Makes Her Throb With Desire, So When I Slip

  • misuzu kawana natsuho imai censoredcreampieIENFi energytiger gavelienfIENF-135IENF1351ienf00135
    • 2021-04-09
    99 min

    374IMGN-002 MIYU(28)

  • amateur censoredmarried womanamateurimgnimgn-002imgn002374imgn-002
    • 2021-04-14
    120 min

    [GVH-224]Naughty Stepmoms/Stepsons Nanami Mineta

  • nanami mineda censoredcreampiemomGVHglory questkabin kizakuraGVH-224GVH22413gvh00224
    • 2021-05-05
    120 min

    [TUE-112]A Video Of Filthy Intercourse That Took Place In A Car

  • censoredcreampiebig titsTUEglay zteitora eizoTUE-112TUE11212tue00112
    • 2021-05-29
    61 min

    C0930 ki210530 Natsuki Mishima 29years old

  • amateur uncensoredc0930
    • 2021-06-04
    43 min

    520SSK-005 Miku

  • amateur censoredcreampieamateursskssk-005ssk005520ssk-005
    • 2021-06-15
    47 min

    481SACZ-038 Sachiyo 4

  • amateur censoredamateurmature womansaczsacz-038sacz038481sacz-038
    • 2021-06-25
    54 min

    FC2PPV 1888200 [Personal shooting] Immature beautiful young wife and affair Enko! Excited by the female genitals of bristles and vaginal cum shot [Amateur Gonzo]

  • amateur uncensoredfc2
    • 2021-06-26
    170 min

    [AUKS-127]

  • future sunohara misaki azusa censoredsquirtinglesbianAUKSu kroshilvia takiguchiAUKS-127AUKS127auks00127
    • 2021-07-03
    64 min

    SIRO-4508 [First shot] [Small animal carnivorous gal] [Marshmallow butt that seems to be squirming] Heavyweight libido hidden in the minimum class body. The finest white gal who felt unsatisfactory with her boyfriend and saffle fully released her sex

  • amateur censoredamateursirosiro-4508siro4508siro-4508
    • 2021-07-09
    52 min

    ZOCT-011 Monami (Pornstar Name)

  • amateur censoredcreampieamateurzoctzoct-011zoct011zoct-011
    • 2021-07-18
    134 min

    [AGAV-059]

  • miona hori censoredsingle workbukkakeAGAVsex agent daydreamersdaibutsu yoshidasex agentAGAV-059AGAV059agav00059
    • 2021-07-22
    142 min

    [DLDSS-018]"I Want You To Fuck Me Until I Lose My Mind ..." Lusty And TIght Sex That Will Expose Her True Self Riho Agatsuma

  • riho gazuma censoredbig titssingle workDLDSSdahliaskyscraperDLDSS-018DLDSS0181dldss00018
    • 2021-08-05
    183 min

    [SHIND-014]Train Groping Of Closeup Masochist - Home Invitation Record #27/28

  • censoredamateurSHINDshinkirousuzuki o maSHIND-014SHIND014h-1560shind00014
    • 2021-08-13
    141 min

    [BLK-512]Sudden Reverse Pick Up Harem Wagon! If You"re Going To Have Sex With Dull Women, Better Fuck With Us!! Nene Tanaka, Ruka Inaba

  • nene tanaka inaba censoredcreampieslutBLKkira kirasamoarikira hosi kira black galBLK-512BLK512blk00512
    • 2021-08-30
    75 min

    328HMDN-402 [Individual Shooting, G Cup 171 Cm] Personal Shooting Of A Beautiful Nurse 39 Years Old Being Humiliated By Her Husband’s Best Friend And Being Vaginal Cum Shot

  • amateur censoredcreampiebig titshmdnhmdn-402hmdn402328hmdn-402
    • 2021-09-03
    119 min

    [SHKD-964]Unless This Married Woman Gets Fresh Sperm Injected Into Her Pussy Within 48 Hours, She"ll Die, So In Order To Keep On Living, She"s Decided To Let That Man, Whom She Hates With A Passion, Creampie Fuck Her. Hikari Ninomiya

  • hikari ninomiya censoredsingle workdramaSHKDattackersmaeda bungoushi yoru akuSHKD-964SHKD964shkd00964
    • 2021-09-09
    40 min

    [IENFH-009]I Was Playing Pranks On My Big Stepsister That Night, But Then She Turned The Tables On Me And Fucked Me Raw, And I Was About To Cum, But Then She Locked Me Down With Her Legs And I Couldn"t Escape, So I Ended Up Creampie Cumming Insid

  • minami kozue censoredcreampieIENFHi energychrysanthemumienfIENFH-009IENFH0091ienfh00009
    • 2021-10-03
    54 min

    398CON-087 Keiko Akahori (60)

  • amateur censoredcreampieamateurconcon-087con087398con-087
    • 2021-10-08
    206 min

    [HUNTB-111]"It Feels Better Than Usual." When She Had A Few Sips And Wanted To Have Sex, The Person She Straddled Was Not Her Boyfriend, But Her Boyfriend"s Best Friend! Without Noticing It, She Stuck It In At Once!

  • censoredcreampieblowjobHUNTBhuntermorikihhh groupHUNTB-111HUNTB111huntb00111
    • 2021-10-15
    62 min

    SIRO-4664 [First Shot] [Beautiful Skin Full Of Transparency] [Pretty Beautiful Girl] Discovered An Active JD With A Beautiful Face That Is As Good As An Idol. The Young And Beautiful Body, Which Has Few Encounters And Frustration, Flushes The White S

  • amateur censoredamateursirosiro-4664siro4664siro-4664
    • 2021-10-22
    68 min

    483SGK-049 [Geki Do M Female College Student] [Vacuum Irama] [Strangling Bikubiku Convulsions Climax] [I Like H Better Than Three Meals] Smile … National Treasure Class! I Was Introduced To A Female College Student With A Very Smiling And Cute I

  • amateur censoredamateursgksgk-049sgk049483sgk-049
    • 2021-11-07
    38 min

    RURA-017 Moe (Pseudonym)

  • amateur censoreduniformamateurrurarura-017rura017rura-017
    • 2021-11-17
    17 min

    10musume 111721_01 Secret Pussy Collection: Rii Kurashina

  • amateur uncensored10musume
    • 2021-11-25
    22 min

    [HEYZO-2662]Mashiro Seto Mashiro’s Orgasms with Toys

  • mashiro seto uncensoredheyzo
    • 2021-11-27
    121 min

    [MCSR-459]"I Do What My Son-in-law Says.." Step-Mother Used As Sex Toy By Step-son She Inherited. Mature Woman Full Cream Pie Ayano Fuji Mako Oda

  • ayano kato oda mako censoredcreampiebig titsMCSRbigmorkalyumejimasukattoMCSR-459MCSR45957mcsr00459
    • 2021-11-27
    59 min

    519MAZOF-026 [Libido In The Second Growth Period! ] Public JK [Impact Video] Examination Student, Dohamari In Sex With Smadra, Ascending To White Eyes With Convulsive Acme That Does Not Stop Real Masochist Female Cum Shot Sexual Intercourse [Outflow]

  • amateur censoredcreampieuniformmazofmazof-026mazof026519mazof-026



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi