bukkake censored javcensored ass fetish




FC2AMBIMIDECESDGVHCAWDSQTEPREDNATRMVSDDASDEBODBBANMARASANDASDONEZNGODKBIABWHUNTB

2020-12-21
151 min

[APKH-158]Beautiful Girl In Uniform Is A Secretly A Freaky Slut! Filthy POV Footage - Cum From A Spectacular Blowjob! She Cums Hard On Cock, And Will Stick Her Tongue In Your Anal Hole! Narumi Hirose

  • narumi hirose censoredcreampieschoolgirlAPKHaurora project annexhaurora project anexAPKH-158APKH158apkh00158
    • 2020-12-24
    59 min

    SIRO-4375 [First shot] [Holiday teacher is an obscene T-back] [Serious climax that shakes the waist] 〇 〇 A cram school teacher who teaches mathematics participates in the war. Madonna’s foolery that fascinates me while being ashamed .. AV applic

  • amateur censoredsquirtingamateursirosiro-4375siro4375siro-4375
    • 2021-01-17
    25 min

    FC2PPV 1649040 [Beautiful girl’s wall push! ] Small animal girl Kanon-chan shock debut! I couldn’t stand it because it was too cute and I tried to insert it raw without permission even after ejaculation!

  • amateur uncensoredfc2
    • 2021-01-29
    44 min

    [fan-097]あいる

  • amateur censoredbig titsamateurfanfan-097fan097fan-097
    • 2021-01-29
    60 min

    [MNSE-009]After School Erotic Photography - G-Cup Slut Happily Takes A Creampie.

  • censoredcreampiebig titsMNSEcrystal picturemaniac plusMNSE-009MNSE00949mnse00009
    • 2021-01-29
    41 min

    490FAN-091 Megu

  • amateur censoredamateurfanfan-091fan091490fan-091
    • 2021-01-29
    120 min

    [NEM-052]Stepmom's Ass Pull Out In Full View: Family Fun 1 Chisato Shoda

  • shota chisato censoredcreampiebig titsNEMglobal media entertainmentkikujiro akabanenewmomNEM-052NEM052143nem00052
    • 2021-02-06
    239 min

    [HUNTA-944]My Horny Sister-In-Law Ran Away From Home And Mounted Me For Some Cowgirl Creampie Sex, And After That, While Her Pussy Was Still Flowing With My Cum, She Mounted Me Again For Some More Second Helping Piston Cowgirl Sex, Over And Over Agai

  • censoredcreampieHUNTAhuntercognac kaminohhh groupHUNTA-944HUNTA944hunta00944
    • 2021-02-12
    116 min

    [IPIT-016]My Busty Stepsister Never Wears A Bra And It's Driving Me Crazy! So I Wait Until My Parents Go To Sleep And Then Fuck This G-Cup Every Single Night! Misa Amagami

  • misa tenjo shinshiro censoredbig titsschoolgirlIPITidea pocketideapocket talent discovery projectIPIT-016IPIT016ipit00016
    • 2021-02-17
    59 min

    SIRO-4428 [First shot] [Cool girlfriend ..] [Smeared in cloudiness] A serious girl with a cool reaction actually made a big stain on her underwear. Honest body seeks pleasure .. AV application on the net → AV experience shooting 1466

  • amateur censoredamateursirosiro-4428siro4428siro-4428
    • 2021-02-27
    119 min

    [MIDE-893]Salon de Slut: Beauty Salon Welcoming Hard Dicks With Sweet Whispers And Colossal Tits - Fumika Nakayama

  • nakayama fumika censoredbig titsslutMIDEmoodyzsamoarimoodyz divaMIDE-893MIDE893mide00893
    • 2021-03-12
    61 min

    [DPL-008]Amateur Female Karate Figher VS Male Amateur Wrestler And Actor Natsuki Nagahara 22 Years Old

  • nagatsuki natsuki censoredDPLplay entertainmentDPL-008DPL008h-1557dpl00008
    • 2021-03-13
    69 min

    FC2PPV 1724510 [Goodbye] A popular child on a certain site and his cute friend’s first 3P W vaginal cum shot

  • amateur uncensoredfc2
    • 2021-03-20

    FC2PPV 1734592 Personal shooting Miya "Video of raw vaginal cum shot with 22 years old"

  • amateur uncensoredfc2
    • 2021-03-25
    184 min

    [SVDVD-847]Ravished! The Chains Of Betrayal! Private Girls' School S*****t! If You Don't Want My Creampie, Call Your Friends! She Calls Her Own Mother, Who In Turn Calls A Friend To Take Her Place! Made To Cum With Endless Pounding And Creamp

  • natsu tojo otohana eve censoredcreampiesquirtingSVDVDsadistic villagenew kage kazamabanging girlsSVDVD-847SVDVD8471svdvd00847
    • 2021-03-27
    240 min

    [JKSR-486]"I Want You To Make Love To Me..." Horny, Innocent Wives Indulge In The Ultimate Carnal Sin: Adultery 14 Married Women, 4 Hours

  • mihina azumihina mihina nagai southern eyebrows censoredbig titsJKSRbig morkalprink junkyJKSR-486JKSR48657jksr00486
    • 2021-03-28
    49 min

    491TKWA-067 Shake The Big Areola Exposed From The Swimsuit Of A Fair-Skinned Muchimuchi Big Tits Girl And Cum Inside A Thick Pussy

  • amateur censoredcreampiebig titstkwatkwa-067tkwa067491tkwa-067
    • 2021-03-29
    63 min

    292MY-434 Ami Ogawa 2

  • amateur censoredcreampiebig titsmymy-434my434292my-434
    • 2021-04-10
    92 min

    [NSPS-982]Eager Sex 8 Wife Falls In Love With Sex With Her Attacker Ayaka Muto

  • ayaka muto censoredmature womansingle workNSPSnagae stylenagaeNSPS-982NSPS982nsps00982
    • 2021-05-10
    52 min

    FC2PPV 1809011 Private lesson with a real big breasts instructor ★ Approximately 2 hours of Rie’s desire for stimulation ★ First time 300 people limited benefits available

  • amateur uncensoredfc2
    • 2021-05-14
    118 min

    [SSIS-062]Ultimate Body, Ultimate Sex Extreme Ejaculation Special That Will Fulfill All Of Your Dreams Yua Mikami

  • yua mikami censoredsingle workSSISs1 no 1 styletake dSSIS-062SSIS062ssis00062
    • 2021-05-18
    135 min

    [SDMM-090]One-Way Mirror Cab - Ayaka Mochizuki X Yuri Honma - Could You Resist These Sex Goddesses？ These Natural Sluts Try To Score With You In This Reverse Pick Up Special! Hung College S*****t Gets Ravished Edition

  • ayaka mochizuki really censoredcreampiesquirtingSDMMsod createzampamagic mirrorSDMM-090SDMM0901sdmm00090
    • 2021-06-04
    119 min

    [BBAN-328]"But Still...I Don't Love You" Ravished By The Female Coworker I Hate... Hijiri Maihara Yui Hatano

  • kiyoshi maihara yui hatano censoredlesbiandramaBBANbibianBBAN-328BBAN328bban00328
    • 2021-06-11
    40 min

    FC2PPV 1862550 Limited number [Uncensored] Active professional student with a lovely smile like a girl! Raw vaginal cum shot at 19 years old! !!

  • amateur uncensoredfc2
    • 2021-06-15
    91 min

    [THNIB-072]Ultimate Girlfriend. /Miu

  • censoredbig titsbeautiful girlTHNIBcraneTHNIB-072THNIB072h-706thnib00072
    • 2021-06-17
    71 min

    [AKDL-118]KDK [Destruction] I PersuadedThis Girl. Marino, 24 Years Old, Works At A Real Estate Agency - Marino Yura

  • yura marino censoredbig titsAKDLaquinoriaquinoriaknrAKDL-118AKDL1181akdl00118
    • 2021-07-02
    83 min

    483SGK-031 [Unprecedented Ikippa] [Eros bare IT company OL] [Gakuburu endless cum] [Iku if inserted! Transcendental sensitive constitution] [Eloy woman who makes a man stubborn] I was waiting for such a woman! If you insert it, it’s cool! Iku wi

  • itol censoredamateursgksgk-031sgk031483sgk-031
    • 2021-07-26
    50 min

    285ENDX-355 I’M So Embarrassed But Bottomless And Sensitive JD

  • amateur censoredcreampieamateurendxendx-355endx355285endx-355
    • 2021-08-09
    49 min

    Caribbeancom 080921-001 The Horny Bride: She Is So Wet Under Her Wedding Dress Emi Aoi

  • emi aoi uncensoredcreampiehandjobcaribbeancom
    • 2021-08-20
    117 min

    [HMN-026]Fresh Face: A Beautiful Girl Who Works For A Travel Company - She Wants To Have An Extraordinary Sexual Experience, So She Started Her AV Debut With A Creampie!! Emi Imai

  • emi imai censoredcreampiebeautiful girlHMNhonnakataiga kosakaiHMN-026HMN026hmn00026
    • 2021-08-26
    195 min

    [NHDTB-567]Girls" Lesbian Pleasure Points Massage Parlor 2. Fondling And Nipple Play For An Innocent Body That Can Barely Take The Endless Orgasms

  • censoredlesbianNHDTBnatural highsakurai baniraNHDTB-567NHDTB5671nhdtb00567
    • 2021-08-28
    240 min

    [JKSR-507]We"ll Film POV Videos Of Local Amateur Housewives 22 Loose Wives From The Kansai Region 4 Hours

  • censoredcreampiemarried womanJKSRbig mocalobockeypink junkieJKSR-507JKSR50757jksr00507
    • 2021-09-09
    92 min

    240TOKYO-431 Miyu

  • amateur censoredamateurcosplaytokyotokyo-431tokyo431240tokyo-431
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-16
    75 min

    200GANA-2558 "What？ Do You Want To Spear？ Lol] Picking Up A Nice Shibuya Gal! It Looks Strong And Is Actually De M! ？？ A Large Amount Of Peeing That Makes You Feel Like You’Re Hit In The Ass And The Bed Is Full! The Turbulence Is Too Erotic!

  • amateur censoredbig titssquirtingganagana-2558gana2558200gana-2558
    • 2021-09-16
    107 min

    [AARM-017]The Pleasure Of Pressing Your Cock Against Her Fully Panty-Covered Ass And Ejaculating Like A Geyser Of Cum

  • arimura nozomi miu susaki censoredbukkakeAARMaroma kikakuhamu oujiaromaAARM-017AARM017aarm00017
    • 2021-09-17
    82 min

    FC2PPV 2212716 J-Cup-Chan And Kan * Re Kaohsiung ♪ In Bright Red Echii Underwear-Ecchi Edition- [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-09-17
    130 min

    [BLK-517]Rough, Vulgar Hips - Maria Nagai

  • maria nagai censoredbig titssquirtingBLKkira kirakira hosi kira black galBLK-517BLK517blk00517
    • 2021-09-20
    240 min

    [MGDN-160]Mature Woman With Thick, Huge Hanging Tits Falls For Young Cock In Creampie Fuck 240 Minutes

  • censoredcreampiebig titsMGDNstar paradisemegadonMGDN-160MGDN160h-254mgdn00160
    • 2021-09-24
    115 min

    [HMN-053]Adult Videos Shot From The Top Down!! I Just Met This Cutie Today, But Her Eyes Totally Told Me To Come With Her... And I Came Inside Her Wan Horikita

  • horikita wan censoredcreampieuniformHMNhonnakahiroaHMN-053HMN053hmn00053
    • 2021-10-01
    85 min

    406FTHT-024 [Cute With Anime Voice Is A Great Weapon! The Piston Shines! A Whip Butt That Pops! Service Princess] Aggressive Excess Lip Service! A Rich Blowjob With An Upper Eye That Tickles The Man’S Heart! Irama In The Back Of The Throat Is Al

  • amateur censoredcreampieamateurfthtftht-024ftht024406ftht-024
    • 2021-10-06
    78 min

    Caribbeancom 100621-001 The Undisclosed: Stunning Blowjob Experience Chisato Takayama, Yui Kawagoe, Rena Sanka, Maki Koizumi

  • amateur uncensoredcaribbeancom
    • 2021-10-07
    104 min

    FC2PPV 2308298 [No Amateur Individual Shooting] The Most Shocking Erotic Cuteness Of Any Woman I Have Ever Met! Loli Face Big Breasts I Cup Former Gravure Idol Married Woman 8 Months Pregnant! Please Be Strong! Will Be Pulled Out! It Is An Incident S

  • amateur uncensoredfc2
    • 2021-10-15
    168 min

    [JUNY-047]Jiggly Colossal Tits On A Beautiful Y********l In Uniform For After School Creampie Amateurs. Misono Mizuhara

  • suwon miso censoredcreampiebig titsJUNYfitchnikuyokuJUNY-047JUNY047juny00047
    • 2021-10-21
    123 min

    [FSDSS-301]Really Close-Up and Sexy Angles of Sexual Negotiations, Minamo Nagase

  • minase nagase censoredbig titsFSDSSfalenoskyscraperfaleno starFSDSS-301FSDSS3011fsdss00301
    • 2021-10-23
    239 min

    [NANX-239]Picking Up Amateur Housewives!! "I Feel Guilty About My Husband" She Says As She Meets A Guy With A Big Dick For Intense Fucking. Wives With Big Tits.

  • censoredcreampiebig titsNANXk m producenanpa heavenNANX-239NANX239nanx00239
    • 2021-10-23
    70 min

    300NTK-654 [Halloween Excitement With Kos H Of The Finest Beauty Bombing A Big Problem Of A Big Orgy Without Rubber! ？？ ] The Bottomless Libido Release That Is Not Afraid Of The God Of Bakujiri Gal! !! Continuous Squeezing Pursuit Sex By Making Full

  • amateur censoredcreampieamateurntkntk-654ntk654300ntk-654
    • 2021-11-09
    30 min

    FC2PPV 2417008 1st Juice Actor Audition October 20 ● East Held Interviewer: Rion [cen]

  • amateur uncensoredfc2
    • 2021-11-25
    139 min

    [SPRD-1484]Step-mother-in-law, You"re Much Better Than My Wife... Iori Nanase

  • iori nanase censoredmature womansingle workSPRDtakara eizokon oriharualeddinSPRD-1484SPRD148418sprd01484
    • 2021-11-26
    85 min

    467SHINKI-067 "Favorite Girl" [Train Molester] [Home Voyeur] [Sleep Rape] A Talented Person In 100 Years Floral Pattern White P (Nanami Yokomiya)

  • amateur censoredcreampieuniformshinkishinki-067shinki067467shinki-067
    • 2021-11-30
    60 min

    [113021-001]Bitch Maid Who Will Having Sex Immediately: Good Morning Master, Oh!

  • emiri miura uncensoredcreampiehandjobcaribbeancom
    • 2021-12-31
    118 min

    [SHKD-984]I Thought You Were My Best Friend, But You"re The Only One, And You"re So Annoying, You Can Fuck Me All You Want!

  • kiyo ami censoredbig titssingle workSHKDwanz factorySHKD-984SHKD984shkd00984
    • 2021-12-31
    120 min

    [SHKD-982]College Girl Gets Fucked By The Older Man Who Started Working At Her Part Time Job Ena Satsuki

  • ena satsuki censoredsingle workSHKDattackerskitorune kawaguchishi yoru akuSHKD-982SHKD982shkd00982
    • 2022-01-13
    93 min

    [OKS-127]Meru Ito Wet And Shiny And Tight A Goddess In A Competitive Swimsuit We Offer You A Cute Girl In A School Swimsuit For Your Viewing Pleasure! Watch Her Change In Peeping Videos, And Check Out Those Tiny Titties, Big Tits, And Shaved Pussy Cu

  • ito meru censoredbeautiful girlsingle workOKSdaddy s private photosgoddess in a school swimsuitOKS-127OKS1271oks00127
    • 2022-01-14
    128 min

    [HODV-21638]Record Of Breaking In A Masochistic Married Woman, Who Surrenders Herself To S&M And Cheating On Her Spouse. Iori Nanase

  • iori nanase censoredcreampiebig titsHODVh m phimu lockHODV-21638HODV216385642hodv21638
    • 2022-01-15
    122 min

    [GTJ-100]Three Lesbians. Fisting Game.

  • aya shiomi yui misaki censoredlesbianbdsmGTJdogmatohjirogold tohjiro labelGTJ-100GTJ100gtj00100



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi