censored def jav paradise mature woman




FC2ATIDAPODHNDHODVSSISWANZABWAUKGAUKGCJODHMNMIDVSPRDMVSDCAWDMEYDWAAANACRONEZIPX

2020-10-29
78 min

[opsen-013]かほ

  • amateur censoredbig titsuniformopsenopsen-013opsen013opsen-013
    • 2020-11-04
    135 min

    [GVH-145]Bored Horny Housewives Throw A Swapping Party For The Whole Neighborhood

  • aishin shinkawa ayaka mochizuki censoredbig titsslutGVHglory questpoison pillGVH-145GVH14513gvh00145
    • 2020-11-06
    39 min

    [gerk-323]かのんさん 2

  • amateur censoredcreampieamateurgerkgerk-323gerk323gerk-323
    • 2020-11-10
    54 min

    H4610 ki201110 Ayumi Ohkawa 24years old

  • amateur uncensoredh4610
    • 2020-11-11
    53 min

    FC2PPV 1566130 [Complete amateur 93] Marin 20 years old Part 4, complete appearance, vaginal cum shot 2 barrage, F cup beautiful girl’s foolery is observed perfectly on 2 screens

  • amateur uncensoredfc2
    • 2020-11-19
    119 min

    [BKD-251]Family Fun [Minami-aizu Karodake Road] Reiko Kobayakawa

  • kobayakawa reiko censoredmature womansingle workBKDrubykoji tsujitobijiBKD-251BKD251bkd00251
    • 2020-11-19
    480 min

    [HHOY-005]"Cut It Out Already..." Girls Claim They Don't Like Getting Hit On At Work, But Their Pussies Are Getting Soaked In Spite Of Themselves - Secret Sluts Highlights Collection.

  • censoredHHOYdinner.companyhhh groupHHOY-005HHOY005hhoy00005
    • 2020-11-29
    500 min

    [SQTE-343]S-Cute Yearly Top Sales Ranking 2020 Top 30 8 Hours

  • kanon kanon aoi kururugi censoredbeautiful girlSQTEs cuteSQTE-343SQTE343sqte00343
    • 2020-11-30
    241 min

    [RD-1027]MILFs Get Naked On Camera For The First Time - 6 Mature Girls, 4 Hours - MILFs In Their Fifties And Sixties With Sparse Pubic Hair -See Their Whole Pussy And Anal Holes

  • censoredmarried womanmature womanRDathena videoathenaRD-1027RD1027149rd01027
    • 2020-12-05
    118 min

    [JUL-390]Ex-Swimsuit Model Married Woman: Exclusive MILFs Volume 3!! A Night Alone Together With My Hot Sister-In-Law During A Blackout... Mizuho Aoyama

  • mizuho aoyama censoredbig titsmature womanJULmadonnashiro shotenJUL-390JUL390jul00390
    • 2020-12-22
    140 min

    [STARS-309]Practicing Making Babies With My C***dhood Friend - Creampie Sex. Suzu Honjo

  • suzu honjo censoredcreampiesingle workSTARSsod creategoemonsod starSTARS-309STARS3091stars00309
    • 2020-12-26
    73 min

    H4610 ki201226 Rrquest

  • amateur uncensoredh4610
    • 2021-01-21
    62 min

    Pacopacomama 012121_424 Ayane Yuuki

  • ayane yuuki uncensoredcreampiebig titspacopacomama
    • 2021-01-21
    122 min

    [HAVD-1004]Unleashed Lesbian Sisters: Sweet Kisses, Melting Touches, Addictive Lesbian Sex

  • blue mamiya nagi censoredlesbianHAVDhibinodr torihamaHAVD-1004HAVD10041havd01004
    • 2021-01-29
    49 min

    [per-362]ゆり

  • amateur censoredbig titssquirtingperper-362per362per-362
    • 2021-02-06
    230 min

    [HUNTA-941]Dangerous Temptation - My Boss's (Teen) Daughter Is Trying To Seduce Me.

  • censoredcreampieschoolgirlHUNTAhunterkawajirihhh groupHUNTA-941HUNTA941hunta00941
    • 2021-02-12
    12 min

    FC2PPV 1683619 I did a lot of ejaculation in the flow at least with a premature ejaculation peni stick to a spear man gal in a sailor swimsuit

  • amateur uncensoredfc2
    • 2021-02-13
    119 min

    [DVAJ-498]I Brought My Colleague To A Hotel And She Spent All Night Sucking My Dick And She Just Wouldn't Quit A Plain Jane Office Lady Kawakami-san Nanami Kawakami

  • kawakami nanami censoredblowjobsingle workDVAJalice japank westDVAJ-498DVAJ498dvaj00498
    • 2021-02-20
    120 min

    [C-2616]Day Trip Spa Mature Woman Lust Trip #017

  • censoredmarried womanmature womanCgogoskoichi takahashicore gogo sC-2616C2616
    • 2021-02-20
    60 min

    324SRTD-0209 If you show off the actor’s tech to a Yariman girl with F cup big breasts, it will be the first place in history

  • amateur censoredbig titsamateursrtdsrtd-0209srtd0209324srtd-0209
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-23
    69 min

    326EVA-162 [4 barrage of vaginal cum shot! ] Looks beyond the perfect model! !! In the daytime, a caregiver’s girls bar cast and a gonzo part-time job are established ☆ A metamorphosis kiss sommelier that you can feel the compatibility of Ji Po

  • amateur censoredcreampieamateurevaeva-162eva162326eva-162
    • 2021-03-05
    130 min

    [HODV-21555]Sensual Sex Licking Every Last Inch Of Your Body Natsu Tojo

  • natsu tojo censoredsingle workHODVh m pk c takedaHODV-21555HODV215555642hodv21555
    • 2021-03-06
    477 min

    [OFJE-301]Which Girl Is Your Type？ A Collection Of The Greatest Super Adult Video Idols Who Will Get You Cumming With Just Their Faces, As They Continuously Stare Into Your Eyes, During French Kissing Sex

  • yua mikami nanatsumori riri censoredbig titsbeautiful girlOFJEs1 no 1 styleOFJE-301OFJE301ofje00301
    • 2021-03-12
    71 min

    FC2PPV 1722965 Tokuno Zaju raw vaginal cum shot on micro bikini layer ♥ "You can make it more intense ♥" [Personal shooting]

  • amateur uncensoredfc2
    • 2021-03-21
    120 min

    [HND-956]Can Ice Cream Shop Workers Become Porn Stars Too？ Simple And Plain Amateur Makes Her Porno Debut Minami Hamasaki

  • minami hamasaki censoredcreampiebeautiful girlHNDhon nakatiger kosakaiHND-956HND956hnd00956
    • 2021-04-08
    77 min

    [230OREC-738]うらら

  • amateur censoredcreampieuniformorecorec-738orec738230orec-738
    • 2021-04-18
    77 min

    300MAAN-645 [Lady’s liberal arts JD / Deep Throating / Saddle tide ecstasy] Contrary to its neat and pretty appearance, I love erotic delusions while reading sensual novels! A sullenly sensitive girl who immediately gets her wet! !! Even more pa

  • amateur censoredcreampiesquirtingmaanmaan-645maan645300maan-645
    • 2021-04-18
    131 min

    [ONSG-034]Big Titted Prostitute - Hinami Naruse

  • hinami narusawa censoredcreampiebig titsONSGgain corporationONSG-034ONSG034onsg00034
    • 2021-04-25
    56 min

    HEYZO 2510 Nonstop Sexual Orgasm – Mika Otowa

  • mika otowa uncensoredcreampiehandjobheyzo
    • 2021-04-30
    257 min

    [HEZ-275]Street Pick Up Of First Class Hot Celeb Mature Chick w/ Creampie Finish 29

  • censoredcreampiebig titsHEZhot entertainmentstudio zerohot premium rose docuHEZ-275HEZ27559hez00275
    • 2021-05-08
    61 min

    HEYZO 2517 FFM Threesome – That’s Man’s Dream! Vol.6 – Miyu Morita – Nana Natsume

  • miyu morita nana natsume uncensoredcreampieblowjobheyzo
    • 2021-05-20
    108 min

    FC2PPV 1827466 [Slutty Bus Tour] Real Doujin Slutty Bus Tour was held. If you get on it, this is the one! Touch, squirting, vaginal cum shot, orgy, anything is OK

  • amateur uncensoredfc2
    • 2021-06-04
    122 min

    [UMD-782]What？! My Friend's Girlfriend Is Hiding In My Bed？! - "Do You Want To Have Sex With Me？ Nobody Can See Us If We Do It Between The Sheets..." 4

  • nene tanaka kiyoshi maihara censoredbig titsUMDleodragon nishikawaUMD-782UMD782125umd00782
    • 2021-06-10
    124 min

    [GS-391]This Big Tits Maid Is Participating In A Private Video Session For The First Time Ever! She'll Aggressively Show Off Her Panties, And When This Maid Puts On All Kinds Of Alluring Poses, That Will Get My Dick Fully Rock Hard. It's Emba

  • censoredbig titsGSsosoru x garconona pGS-391GS3911gs00391
    • 2021-06-11
    159 min

    [DASD-869]She Can't Stand Her Stepdad... But When He Goes Down On Her This Stepdaughter Has Orgasms Like Never Before - Fakecest Cunnilingus Mei Satsuki

  • satsuki mei censoredcreampiebig titsDASDdasgoemonDASD-869DASD869dasd00869
    • 2021-06-26
    90 min

    300NTK-594 [Animal SEX 3 Consecutive Squeezing] 30 Saffle Regular Dovich GAL! !! The aim is the next-generation SEX symbol! !! Hundred battles of apt … No thousand … No! !! Man battle training sex animal woman on top posture with actor seco

  • sexsex censoredcreampieamateurntkntk-594ntk594300ntk-594
    • 2021-07-01
    85 min

    435MFC-120 ["It feels better than your sister？"] Renka and raw SEX with twin erotic sisters who take pride in their feelings more than their sister Ma ● Ko! [Shiroto Gonzo ＃ Renka ＃ 24 years old ＃ Slender big tits]

  • amateur censoredcreampieamateurmfcmfc-120mfc120435mfc-120
    • 2021-07-08
    129 min

    [JRZE-060]First Time Filming My Affair Miyu Koizumi

  • yu koizumi censoredcreampiemature womanJRZEcenter villageminatoyashoku ureJRZE-060JRZE060h-086jrze00060
    • 2021-07-08
    167 min

    [SPRD-1432]Friends With Benefits With My Best Friend's Mom June Lovejoy

  • june lovejoy censoredmature womanmomSPRDtakara eizokon oriharualeddinSPRD-1432SPRD143218sprd01432
    • 2021-07-10
    64 min

    ION-093 Nami

  • amateur censoredamateurbeautiful girlionion-093ion093ion-093
    • 2021-07-14
    141 min

    [SSIS-120]*Completely Uned! POV! No Makeup! Anything Goes! Ichika Hoshimiya's Raw Carnal Instincts Bared For Real Sex! Genuine Couple's Hot Spring Trip Leads To Wild, Rare, 200 Erotic Fuck Footage

  • ichika hoshimiya censoredsingle workSSISs1 no 1 stylehiroyuki kimuraSSIS-120SSIS120ssis00120
    • 2021-07-18
    74 min

    300NTK-607 W Boyne 4p! !! Two Super-Incarnation-Class Beautiful Girls Jd Are Disturbed In The Usual Pool! !! Drink And Make Noise, Continuous Squeezing By The Pool Without A Social Distance Or Con Dome! !! Wet Condition Of Water Level Rise With Under

  • gjdsex censoredcreampiebig titsntkntk-607ntk607300ntk-607
    • 2021-07-31
    240 min

    [YMDD-238]Uhar Bitch Chapter 2 "The Woman You Want, Whenever You Want, Wherever You Want! "

  • censoredbig titsblowjobYMDDmomotaro video publishingdukeyoung peachYMDD-238YMDD238ymdd00238
    • 2021-07-31
    120 min

    [BKD-268]Stepmother and Offspring Mating [Yataro Yamaro] Arisa Habu

  • arisa hanyu arisu hanyu censoredmature womansingle workBKDrubytsuji koujitabijiBKD-268BKD268bkd00268
    • 2021-08-03
    32 min

    FC2PPV 1953566 Today’S Limited [Individual Shooting] Prefectural General Course ③ Ponite Gal. School Skipping 〇 ・ Gonzo With A Flat Face ※ No Eye Moza

  • amateur uncensoredfc2
    • 2021-08-07
    239 min

    [NASH-553]Collection Of Artistic Japanese Romance Books, No. 4: Fucked The Apartment Wife Daydream

  • censoreddramaNASHnadeshikojinryuuyuutakeNASH-553NASH553nash00553
    • 2021-08-16
    73 min

    328HMDN-394 [Miracle Mature Woman] Former Stage Actress Wife 39 Years Old Sns ＃ Wife’S Hcup Big Breasts Grabbed By Sperm Donation And Continuous Seeding Of Direct Shot Of The Pussy. Convulsions Acme To Angry Thick Unequaled Cock Uterus Kiss

  • amateur censoredcreampiebig titshmdnhmdn-394hmdn394328hmdn-394
    • 2021-09-04
    139 min

    [SORA-330]I Want You To Love Every Part Of Me, Down To My Asshole. Yuri-san (34 Years Old) Anal Fuck / A 2-Hole Threesome Fuck Fest / Colossal Tits / A Tiny Body / Asshole Ecstasy / Consecutive Cumming / Amateur / Married Woman

  • hamazaki mao censoredsingle workdramaSORAyama to sorayo sukeSORA-330SORA330sora00330
    • 2021-09-04
    98 min

    [USBA-032]Having Sex With My Coach As A S*****t And He Called It Training Riho Fujimori

  • riho fujimori censoredbig titssingle workUSBAavsusubashi suiavscollectorsUSBA-032USBA032usba00032
    • 2021-09-25
    149 min

    [NITR-512]Filthy BODY: Tongue Kissing Addiction IV - Honoka Tsujii

  • tsujii honoka censoredcreampiebig titsNITRcrystal eizoupearlrice sakagaminitroNITR-512NITR512nitr00512
    • 2021-10-01
    122 min

    [NACR-471]Drenched By A Sudden Rainstorm ... My Favorite Private Tutor Couldn"t Find Her Way Home Reona Tomiyasu

  • takehiro tomiyasu censoredbig titssingle workNACRplanet plushimurokkushichi ku ryuuNACR-471NACR471h-237nacr00471
    • 2021-10-02
    55 min

    188HINT-0484 Rinko

  • amateur censoredamateurhinthint-0484hint0484188hint-0484
    • 2021-10-15
    116 min

    [PPPD-971]Modest Older Step-sister With Big Tits Has An Expert Holding Grip To Work That Dick And Drain Those Balls Of Cum Over Summer Vacation. Tomoko Kamisaka

  • tomoko kamisaka censoredcreampiebig titsPPPDoppaiPPPD-971PPPD971pppd00971
    • 2021-10-15
    105 min

    [VEC-499]A Secret Between Me And My Friend"s Mother. Forcibly Had Creampie Sex With Her... Miyu Tsubakihara

  • miyu tsubakihara censoredcreampiemature womanVECvenussarumegami venusVEC-499VEC499vec00499
    • 2021-10-15
    240 min

    [DVDMS-729]Colossal Tits. Slut With Milky Jugs To Suck. Curvy College Girl With Super Sexy Tits For Ample Fun! Hot, Sweat-dripping Fucking For This Amazing Big Titty Slut.

  • ena koume himesaki hana censoredbig titsslutDVDMSdeepsmotofuji peroflavorsDVDMS-729DVDMS729dvdms00729



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi