censored jav schoolgirl creampie planning




FC2DASDVEMAKBISHKDAUKGSSNIBLKHMNVENUPREDJULMARADASDSTARSFSDSSATIDHDKASPRDMILKMVSD

2020-11-07
235 min

[ARAN-009]The Cruel Anal Orgasm Legend This Woman Is Getting Both Her Sensitive Holes Targeted For Orgasmic Pleasure When She Has An Anal Orgasm Her Mind Will Be Blown To Oblivion!! INFERNO BABE ULTRA FILM

  • megumi shino emma kisaki haruki haruki kato censoredanalbdsmARANbabyentertainmentshiroto musume kyoso kyokuARAN-009ARAN009aran00009
    • 2020-11-19
    109 min

    [OBD-068]This Ass Princess Is Actually A Grandmother - Emi Enda

  • emi toda censoredmature womanOBDrubysukeroku katouOBD-068OBD068obd00068
    • 2020-11-23
    133 min

    [ANZD-048]She Has Fucked Over 1000 Guys! She Goes To Social Mixers Every Day Looking For Men To Fuck - Super Aggressive Girl Yuu

  • censoredcreampieamateurANZDanzu daydream vacationanzuANZD-048ANZD048anzd00048
    • 2020-11-23
    153 min

    [ANZD-051]Maid Cafe Waitress Riri (20) Loves Sperm - Kinky Slut Who Wants Cum Facials All Over Her Glasses - She Swallows 9 Loads

  • censoredamateurbukkakeANZDapricot mousouapricotANZD-051ANZD051anzd00051
    • 2020-11-26
    124 min

    [MILK-096]120 Minutes Of Totally Uncut Sex It's Time To Overcome The Temptation Of The Cock Squad The Nonstop Masturbation Challenge Riona Minami

  • rina minami censoredsquirtingbeautiful girlMILKmilkMILK-096MILK096h-1240milk00096
    • 2020-12-04
    69 min

    FC2PPV 1594206 * Limited to 3 days ♥ Normal 6000⇒3980pt ★ First shot super rare appearance ☆ Unreasonably cute innocent beautiful girl Yuri 18 years old ☆ Baby face little devil ♥ Nasty Dirty Little Exposed Zubotto Raw Saddle Lust Creampie ♥ [With be

  • amateur uncensoredfc2
    • 2020-12-16
    135 min

    [GVH-166]Breeding My Stepsister And My Stepmom - They Came To The Big City To Get Bred - 3 Days With My Horniest Relatives And Their Big Tits Ruka Inaba / Kyoko Maki

  • inaba maki kyoko censoredbig titssisterGVHglory questusubashisuiGVH-166GVH16613gvh00166
    • 2020-12-21
    240 min

    [ARAN-012]The Crudeness Of The Electric Drill That Will Make Any Woman Go Mad Her Passion Burns Hot In Her Deep Nether Regions 47 Ladies Spasm To Consecutive Orgasmic Ecstasy!! A Dynamite Massive Pictorial INFERNO BABE ULTRA FILM

  • censoredbdsmARANbabyentertainmentshiroto musume kyoso kyokuARAN-012ARAN012aran00012
    • 2020-12-26
    61 min

    1Pondo 122620_001 Model Collection: Non Suzumiya

  • amateur uncensored1pondo
    • 2020-12-27
    120 min

    [AUKG-502]Me And My Classmate - Re: Matsuna & Chiharu - Lesbian S********ls Chiharu Sakurai Matsuna Koga

  • chiharu sakurai matsuna koga censoredschoolgirllesbianAUKGu krentoAUKG-502AUKG502aukg00502
    • 2020-12-29
    135 min

    [STARS-313]Soft Breasts (H-Cups) Massaged To Develop Their Erotic Potential - First Orgasms, 3 Full Fucks Kurumi Hanamaru

  • hanamaru kurumi censoredbig titssingle workSTARSsod createzaku araisod starSTARS-313STARS3131stars00313
    • 2021-01-01
    120 min

    [NACR-386]Record Of Sex With A Son's Wife - Yuki Sakurami

  • miyuki sakura censoredcreampiemarried womanNACRplanet pluscherryshichidomeNACR-386NACR386h-237nacr00386
    • 2021-01-24
    155 min

    [NSPS-964]Lusty Wives Crave Other Men's Bulges

  • yuri nikaido sumire seto censoredmature womandramaNSPSnagae stylejotaro tomiNSPS-964NSPS964nsps00964
    • 2021-01-28
    59 min

    SIRO-4406 [First shot] [Height 170 cm x model body] [Shy girl’s foolery] A tall model girl participates in the war. When giving a violent piston in an obscene position that fascinated long legs .. Application amateur, first AV shooting 188

  • amateur censoredamateursirosiro-4406siro4406siro-4406
    • 2021-02-10
    74 min

    [opcyn-149]すず(20)

  • amateur censoredamateurbeautiful girlopcynopcyn-149opcyn149opcyn-149
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-03-09
    133 min

    [KIRE-028]Motherly H-Cup Forty Something With Beautiful Tits There's Nothing This Health Supplement Saleswoman Won't Do To Forever Feel Like A Young Powerful CEO! Yumi Narusaki 46 Years Old Porn Star Debut

  • grace narisaki censoredbig titsmature womanKIREsod createyosukebeauty kirei sodKIRE-028KIRE0281kire00028
    • 2021-03-12
    115 min

    [DHT-247]Car Sex Challenge! Sumire Tanba

  • niwa sumire censoredbig titsDHThot entertainmentDHT-247DHT24759dht00247
    • 2021-03-13
    63 min

    Caribbeancom 031321-001 Mika Sumire who loves deep throat keeps cumming!

  • mika sumire uncensoredcreampiecaribbeancom
    • 2021-03-26
    118 min

    [MIAA-416]My World Was Changed At A Breast Milk Massage Parlor For Men... Hinami Narusawa

  • hinami narusawa censoredcreampiebig titsMIAAmoodyztequilia tinoeveryone s porn starMIAA-416MIAA416miaa00416
    • 2021-04-03
    127 min

    [SORA-305]"Look At My Shameful Body" Perverted Masochistic Slut Is Open For Business! Momo Hazuki

  • hazuki peach censoredsingle workSORAyama to soratrippyySORA-305SORA305sora00305
    • 2021-04-22
    480 min

    [FCDSS-009]This Intellectual College Girl Wants To Be A Female Anchor, But Right Now She's In The Middle Of Furious Vaginal Orgasmic Piston-Pumping, Cum Pissing Dirty Talk NTR!! Natsu Tojo In Her First Best Hits Collection Full Course Fuck Fest 8

  • natsu tojo censoredbeautiful girlFCDSSfalenofaleno starFCDSS-009FCDSS0091fcdss00009
    • 2021-04-29

    FC2PPV 1794238 ☆ First shot ☆ Complete appearance ☆ Beautiful beauty witch 52 years old! Glamorous body with plenty of sex appeal ♥ Squirting turbulent squirting Creampie SEX ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-05-21
    55 min

    FC2PPV 1829554 * Weekend limited 6000⇒3980pt ★ Inverted nipple transcendental beauty BODY’s super cute Aimi-chan 19 years old ☆ Systemic erogenous zone ♥ Sensitive bristle pussy rolls up ♥ Excitement MAX super squirrel mass cum shot that perfect

  • amateur uncensoredfc2
    • 2021-05-22
    241 min

    [SGSR-279]Real Recorded Experiment - Has This Happened To You？ Your Daughter Brought A Friend Over, And You Bumped Into Her While She Was Changing! Things Might Happen Between A Beautiful Girl With A Nice Naked Body And An Older Guy! Unexpected Eroti

  • censoredbig titsbeautiful girlSGSRbig morkaleigyochuushinsengumiSGSR-279SGSR27957sgsr00279
    • 2021-05-25
    54 min

    FC2PPV 1835944 First shot ❤️ We will deliver from corner to corner of a Ubu woman who does not know the world yet [Personal shooting]

  • amateur uncensoredfc2
    • 2021-06-04
    82 min

    259LUXU-1434 Luxury TV 1413 A beautiful make-up artist is fascinated by the previous sex and reappears! Contrary to her cool impression, she describes herself as an M type … She obeyed the instructions of an unpleasant man while dyeing her cheek

  • amateur censoredbig titsamateurluxuluxu-1434luxu1434259luxu-1434
    • 2021-06-18
    94 min

    [393OTIM-079]【妄想主観】会社の後輩とホテルで逆NTR不倫物語 永澤ゆきの

  • amateur censoredcreampieamateurotimotim-079otim079393otim-079
    • 2021-06-26
    80 min

    383REIW-077 Mari

  • amateur censoredcreampieamateurreiwreiw-077reiw077383reiw-077
    • 2021-06-26
    240 min

    [BDSR-453]Slippery Competition Swimsuit Goddesses 9 Girls 4 Hours

  • censoredamateurBDSRbig morkaljiro kanekoBDSR-453BDSR45357bdsr00453
    • 2021-06-26
    124 min

    [JJCC-003]Unfaithful Wife Misa Wants Some Sperm

  • censoredcreampiebig titsJJCCjukujo japanJJCC-003JJCC003jjcc00003
    • 2021-07-01

    C0930 ki210701 Yuriko Onishi 43years old

  • amateur uncensoredc0930
    • 2021-07-01
    78 min

    200GANA-2507 Seriously Nampa, first shot. 1656 Ask JD who picked up in Shibuya to shoot a slightly mature image video! I was dazzled by the rewards, and when I left myself to the flow … I was completely naked! Slender and small! I feel the cute

  • amateur censoredsquirtingamateurganagana-2507gana2507200gana-2507
    • 2021-07-09
    147 min

    [IPX-693]If You Don't Want to Be Caught, Take Off Your Clothes. Shopping Lifting Beauty...You Can't Go Home. Insistant Tragedy. Minato-kun Women's Edition Yume Nishimiya

  • yume nishinomiya censoredcreampiedeepthroatIPXidea pocketkyouseitissueIPX-693IPX693ipx00693
    • 2021-07-27
    102 min

    SHPV-001 Momoasu

  • amateur censoredamateurbeautiful girlshpvshpv-001shpv001shpv-001
    • 2021-08-06
    240 min

    [MUKD-465]Erotic Services Offered In Gym Clothes! Mouths, Hands, Thighs, And Ass-Jobs Will Make You Feel Bliss, Plus Tons Of Cum Bukkake On School Gym Shorts - 10 Beautiful Teens, Deluxe Edition With Bonus Footage, 4 Hours

  • marina saito takanashi arisa censoredblowjobbeautiful girlMUKDinnocentMUKD-465MUKD465mukd00465
    • 2021-09-09
    160 min

    [MIST-349]Nipple Insanity A Nipple Girl From Tokyo Who Can Control Your Pleasure And Make You Ejaculate, Squirt, And Dry Orgasm From Her Skilled Nipple Play Tsubaki Kato

  • kato camellia kaoru natsuki censoredsquirtingmature womanMISTmr michirumiyoshi rusherMIST-349MIST3491mist00349
    • 2021-09-18
    86 min

    FC2PPV 2217618 Crying! !! Tears. "Genuine Amateur" "Genuine Tears" Foreign-Affiliated Cosmetics Salesperson, "Tears Porori" Lori Beautiful Amateur Beauty S ○ X Begins To Cry, And Even If She Is Crying, She Cums Inside The Bea

  • amateur uncensoredfc2
    • 2021-09-29
    78 min

    259LUXU-1451 Luxury TV 1463 A Beautiful Female Doctor (Proctology) In Her Second Year Of Marriage Appears On AV! Marital Relationship Is Good, But Sex Is Normal And Unsatisfactory! "I Want To Live With All My Strength …" A Beautiful Wife

  • amateur censoredmarried womanamateurluxuluxu-1451luxu1451259luxu-1451
    • 2021-10-15
    153 min

    [MVSD-484]She"s Breaking Bank With Her Bitch Ass P*ssy! This Horny Broke Gal Played Around Too Much During Summer Break, So Now She"s Working A Secret Side Hustle With Creampie Sex!

  • censoredcreampiebig titsMVSDm s video groupms video groupMVSD-484MVSD484mvsd00484
    • 2021-10-19
    97 min

    [101921_001]セクシー女優スペシャル版 ～ 百合川さら 瞳ゆら ～

  • amateur uncensored1pondo
    • 2021-10-23
    220 min

    [NASH-594]Unfaithful Housewife Comes To Tokyo To Fuck Another Man

  • censoredcreampieamateurNASHnadeshikopermaNASH-594NASH594nash00594
    • 2021-10-23
    149 min

    [APKH-189]"I Love Your Cum Loads!" Charming, Innocent E-cup Beautiful Y********l In Uniform Hooks Up With Her Teacher At A Love Hotel For POV Action. Ena Satsuki

  • ena satsuki censoredschoolgirlblowjobAPKHaurora project annexhAPKH-189APKH189apkh00189
    • 2021-11-07
    128 min

    300MIUM-758 [G Cup From H Cup] Rent A Manipulative Teacher As Her! Completely Rec The Whole Story That Was Spoiled Up To The Originally Prohibited Erotic Acts By Persuading! !! After Enjoying A Pool Date In A Swimsuit, Naked Sex & Erokos Oil Sex A

  • amateur censoredcreampiebig titsmiummium-758mium758300mium-758
    • 2021-11-19
    155 min

    [JUL-775]Beautiful Scandinavian Blonde"s Madonna-Exclusive Debut Special! Clear Blue Eyes.. Pale White Skin... Wavy Blonde Hair... Three Full Passionate Fucks Lily Hart

  • lily heart censoredmature womansingle workJULmadonnamamezawa mametarouJUL-775JUL775jul00775
    • 2021-12-05
    65 min

    TMEN-001 Alice (Nozomi Alice)

  • amateur censoredcreampiebig titstmentmen-001tmen001tmen-001
    • 2021-12-18
    111 min

    [DDFF-018]Life Is A Psycopath. Mummify Bitch Who Ruined Your Life And Poke Her In The Pussy. Yui Tenma

  • yui tenma censoredcreampiedeepthroatDDFFdogmafk 2DDFF-018DDFF018ddff00018
    • 2022-01-06
    147 min

    [FANH-052]Newlywed 20-something Kansai Woman Konomi-chan Visits Tokyo, Films Herself Fucking Her Ex Hot French Kissing SEX Cuckolding Creampie

  • censoredcreampiemarried womanFANHhamedori.network secondeditionFANH-052FANH052h-1472fanh00052
    • 2022-01-07
    39 min

    FC2PPV 2576638 ＃ Immediate Deletion Attention [Complete First Shot Chest Kyundo M Beautiful Girl] [No Individual Shooting] ★ 18-Year-Old Body Is Really Comfortable With Punipuni ★ Extremely Dangerous Problem Work Taken Half A Year Ago! !! Genuine Fir

  • amateur uncensoredfc2
    • 2022-01-13
    135 min

    [STARS-486]ドバドバ精子垂れ流し無限昇天イメクラエステ4COSPLAY3sex MINAMO

  • minamo censoredSTARSsod createmonsod starSTARS-486STARS486
    • 2022-01-22
    120 min

    [BLB-015]Beautiful Japanese Girl Gets Taken By Giant Black Cock. Her Newly Wed Lifestyle Takes A Serious Turn... A Kindness Born Out Of Distant Days. A Young Wife Faces A Horrific Tragedy After Being Sold To A Friend! (First Time With A Black Guy!) A

  • star ameri censoredsingle workdramaBLBglobal media entertainmentjiro sadogashimablack beastBLB-015BLB015blb00015
    • 2022-02-05
    120 min

    [NACR-503]My First Lover Whom I Cannot Forget - Mina Wakadzuki

  • miina wakatsuki censoredcreampiebig titsNACRplanet plusbito sakurananakuruNACR-503NACR503h-237nacr00503
    • 2022-02-19
    138 min

    [CEMD-134]Lusty Slut With The Power To Stop Time! Yui Hatano Uses Her Spell To Make Men Cum Over And Over!

  • yui hatano censoredbig titsmature womanCEMDceleb no tomoCEMD-134CEMD134cemd00134
    • 2022-02-21
    43 min

    521MGFX-040 Excavation ☆ Big Breast Amateur 29

  • amateur censoredbig titsmarried womanmgfxmgfx-040mgfx040521mgfx-040
    • 2022-02-26
    240 min

    [MCSR-471]9 Big Titted Wives Get Cuckolded - 4 Hours Best 2

  • southern eyebrow rina oumi censoredcreampiebig titsMCSRbig mocalbanderas takedamuscatMCSR-471MCSR47157mcsr00471
    • 2022-03-04
    62 min

    FC2PPV 2696825 [No] Forced Deep Throating With A Blindfold And Handcuffs On Almost A Virgin Short Hair Jd! I Put An Electric Dildo And Trained A De M Daughter. Continuous Squirting From A Bristle Pussy! !!

  • amateur uncensoredfc2



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi