censored javcensored jav older sister




FC2ABWSPRDSDABHMNMIDVSTARSMILKGVHCHRVSANWAAAMEYDVENUBLKPREDSQTEDASDPPPDNATRJUFE

2021-02-28
145 min

[LULU-060]It's Late At Night At The Office, And I'm Alone, Working Overtime With My Married Woman Lady Boss! She Was Seated At Her Desk, Facing Me, Flashing Her Beautiful Legs And Panty Shot Action At Me, And When I Gave In To Her Temptation,

  • tsukino luna censoredcreampiesingle workLULUlunaticsluminaxLULU-060LULU060lulu00060
    • 2021-02-28
    133 min

    [BIJN-195]The Document - Orgasmic Sex Driven By Pure Instinct - Her Curvy Body Twitches As She Cums Again And Again - Tsukasa Nagano

  • tsukasa nagano censoredsingle workBIJNbijin majo emmanuelleBIJN-195BIJN195bijn00195
    • 2021-02-28
    76 min

    200GANA-2448 Seriously Nampa, first shot. 1604 Hotel IN at Tay who picks up an older sister with beautiful legs and listens to consultations! Frustrated when she touches her body while consulting her troubles, she is gradually swept away, opens her l

  • amateur censoredamateurganagana-2448gana2448200gana-2448
    • 2021-02-28
    122 min

    [AUKG-506]Lesbian Series: Follower - I Was Targeted By My Neighbor - Nozomi Arimura, Hana Aikawa

  • arimura nozomi aikawa leafy vegetables censoredlesbianslutAUKGuAUKG-506AUKG506aukg00506
    • 2021-02-27
    117 min

    [MIAA-400]They Won't Let You Stop Until You've Cum 10 Times! - This Naughty Soapland Girl Pushes Masochistic Guys Past Their Ejaculation Limits - Riho Fujimori

  • riho fujimori censoredbig titsslutMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-400MIAA400miaa00400
    • 2021-02-27
    56 min

    383REIW-035 Orchid

  • amateur censoredbig titsamateurreiwreiw-035reiw035383reiw-035
    • 2021-02-27
    161 min

    [MIDE-891]Alone With Minami Hatsukawa, Tempting Me By Whispering Slutty Dirty Things In My Ear - 6 Situations Behind Closed Doors

  • hatsukawa minami censoredcreampiecosplayMIDEmoodyzhirokoji osakimoodyz divaMIDE-891MIDE891mide00891
    • 2021-02-27
    124 min

    [MIAA-398]This Despised And Dirty Old Man Was Forbidden From Ever Using This Delivery Health Call Service Again, But To Her Surprise, He Turned Out To Be Her Father-In-Law Newly Wed Lifestyle NTR He Bought The Super Option And Now I'm Cumming Ove

  • tsujii honoka censoredcreampiesingle workMIAAmoodyzham the mceveryone s porn starMIAA-398MIAA398miaa00398
    • 2021-02-26
    81 min

    259LUXU-1390 Luxury TV 1371 “I want to know more about the world of sensuality …” A beautiful music producer descends into the AV world! Carrying abundant beautiful breasts with a neat appearance, captivating a man with a fierce kiss l

  • amateur censoredbig titsamateurluxuluxu-1390luxu1390259luxu-1390
    • 2021-02-26
    76 min

    [FTBL-009]A New Star, The Mole Girl! A Gold Medalist Superstar! Watch Her Spread Her Legs In The M-Shape While Pumping Away With A Spectacular Cowgirl As Her Popularity Rises!! This Slender And Hot-Bodied Beauty Is Getting Her Panties Stained From Al

  • censoredcreampieFTBLfalenodavielfalenotubeFTBL-009FTBL0091ftbl00009
    • 2021-02-25
    160 min

    [MILK-103]Ami Kasai, Complete Combustion. I Am Retiring From Being An AV Actress.

  • kami ami censoredbig titssingle workMILKmilkMILK-103MILK103h-1240milk00103
    • 2021-02-25
    67 min

    OMNK-003 Rina

  • amateur censoredbig titsamateuromnkomnk-003omnk003omnk-003
    • 2021-02-24
    40 min

    [SDFK-042]"Couples Only" In The One-Way Mirror Cab, Your Girlfriend Tries Out A Real Cheating Creampie! Mika (18), College S*****t

  • censoredSDFKsod createyoshiaki nomotomagic mirrorSDFK-042SDFK0421sdfk00042
    • 2021-02-24
    73 min

    259LUXU-1386 Luxury TV 1370 The weather girl who was fascinated by the AV that she had originally avoided and even wanted to appear on her own. I want to be like her longing AV actresses … The pretty body that I polished is no longer as beautifu

  • amateur censoredamateurluxuluxu-1386luxu1386259luxu-1386
    • 2021-02-23
    69 min

    326EVA-162 [4 barrage of vaginal cum shot! ] Looks beyond the perfect model! !! In the daytime, a caregiver’s girls bar cast and a gonzo part-time job are established ☆ A metamorphosis kiss sommelier that you can feel the compatibility of Ji Po

  • amateur censoredcreampieamateurevaeva-162eva162326eva-162
    • 2021-02-22
    80 min

    259LUXU-1391 Luxury TV 1369 A beautiful woman with a strong libido who runs a lingerie shop has appeared! The greedy sexual desire that has accumulated in the pool collapses immediately by depositing it with an electric massage machine. In front of m

  • amateur censoredamateurluxuluxu-1391luxu1391259luxu-1391
    • 2021-02-21
    148 min

    [CJOD-283]Unlimited Ejaculation: Breaking Through A Penis' Limits At A Men's Massage Parlor - No Cutting Corners! Continuous Ejaculating Man Juice! And What's More, You Get A Treatment Where You Can Give As Many Cumshots As You Like! A Co

  • ai mukai censoredcreampieslutCJODchijo heaventequilia tinoCJOD-283CJOD283cjod00283
    • 2021-02-21
    118 min

    [NNPJ-432]*Go-For-Broke Infidelity Videos "My Husband Committed Infidelity ..." A Beautiful Half-Japanese Wife Let Herself Be Seduced And Taken Home And Now She's Losing Her Mind And Forgetting All About Her Husband During A Cum Crazy Bou

  • censoredcreampieblowjobNNPJnanpa japanNNPJ-432NNPJ432nnpj00432
    • 2021-02-20
    134 min

    [PED-006]This Is What Happened When We Left Them Alone For Just 7 Hours ... In The End, They Had 10 Fucks. Satomi Suzuki

  • satomi suzuki censoredsingle workPEDdream ticketkurumi ichinosePED-006PED00624ped00006
    • 2021-02-19
    75 min

    300NTK-521 G milk beauty woman president’s replacement Chiechi 4 launch record! !! Immediately become horny at the aphrodisiac tasting party you bring! !! Contrast of tide & sperm overflowing from continuous vaginal cum shot squeezing Ma ○ K

  • amateur censoredcreampiebig titsntkntk-521ntk521300ntk-521
    • 2021-02-19
    131 min

    [BIJN-194]The Document - Instinctive, Orgasmic Sex Caught On Camera - Screaming, Swooning Orgasms, Beautiful BODY - Extreme Climaxes Hazuki Wakamiya

  • wakamiya censoredbig titssquirtingBIJNbijin majo emmanuelleBIJN-194BIJN194bijn00194
    • 2021-02-19
    81 min

    259LUXU-1383 Luxury TV 1368 “In search of stimulus in every day without anything …” A beauty medical clerk who decided to appear in AV with courage in search of extraordinary pleasure to get out of such flat days. She says there is the

  • amateur censoredbig titsamateurluxuluxu-1383luxu1383259luxu-1383
    • 2021-02-19
    68 min

    [opcyn-156]さくら(23)

  • amateur censoredamateuropcynopcyn-156opcyn156opcyn-156
    • 2021-02-18
    149 min

    [PPPD-905]My Girlfriend's Older Sister Tempts Me With Her Big Tits, Telling Me It's OK To Creampie Her - Ranka

  • ranka censoredcreampiebig titsPPPDoppaiPPPD-905PPPD905pppd00905
    • 2021-02-18
    73 min

    [AKDL-086]He Was Brought Here By His Mama To Be Slut Fucked The Bewitching Beauty Salon "My, You Have Such A Large Cock, I'm Looking Very Forward To Seeing You Grow Up" Occupation: Beautician Name: Miu Miu Akemi

  • akemi miu censoredbig titsslutAKDLaquinoriaquinoriaknrAKDL-086AKDL0861akdl00086
    • 2021-02-17
    79 min

    259LUXU-1385 Luxury TV 1367 A beautiful beautician who feels rewarding for her dream job, but is chased by busy days and suffers from unfulfilled desires away from the warmth of men! While nervous about the big cock she sees for the first time in a l

  • amateur censoredamateurlingerieluxuluxu-1385luxu1385259luxu-1385
    • 2021-02-15
    233 min

    [PYM-365]Self Shots - Limitless Orgasms - Pleasured Pussy Spread Wide For Masturbation

  • censoredPYMprimoPYM-365PYM365h-283pym00365
    • 2021-02-15
    80 min

    259LUXU-1384 Luxury TV 1366 An active fashion magazine model with a cute face, beautiful style, and impeccable looks. Is it because of her willingness to regain her self-confidence, or because of her rushing pleasures that she forgot to open her stri

  • amateur censoredamateurluxuluxu-1384luxu1384259luxu-1384
    • 2021-02-12
    146 min

    [JUFE-258]Big Booty Stepsister Can't Resist Her Hung Stepbrother - She's A Married Woman Now, But That Doesn't Mean This Innocent Slut Isn't Down To Cheat! Akari Neo

  • akari neo censoredcreampiesingle workJUFEfitchJUFE-258JUFE258jufe00258
    • 2021-02-12
    58 min

    [DHT-244]Please Introduce Me To Someone Hornier Than You! 4 A Horny Bitch's Friend Has To Be A Horny Slut Too! Anyone Can Agree, These Girls Are The Sure Thing, Guaranteed To Be A Great Fuck, No Matter How Many Times They Fuck, So Here We Are, Fu

  • censoredcreampiebig titsDHThot entertainmentyen ikkiDHT-244DHT24459dht00244
    • 2021-02-12
    164 min

    [BOKD-212]A Man's Daughter Is A Gal Bitch: I Might Look Like This, But I Have A Penis. Izumi

  • izumi censoredcreampiebig titsBOKDwe re she malesdorikawaBOKD-212BOKD212h-995bokd00212
    • 2021-02-12
    118 min

    [IPX-619]"Gross, Don't Touch Me..." The Tables Have Turned! You Hired A Call Girl For A Quick Blowjob, And Your Annoying Boss Showed Up! Time To Take It Out On Her Body! Stress-Relieving Hard Pounding Fucks! Airi Kijima

  • airi kijima censoredcreampiesingle workIPXidea pocketkyoseidishIPX-619IPX619ipx00619
    • 2021-02-12
    59 min

    [DHT-246]Please Introduce Me To Someone Hornier Than You! 4 A Horny Bitch's Friend Has To Be A Horny Slut Too! Anyone Can Agree, These Girls Are The Sure Thing, Guaranteed To Be A Great Fuck, No Matter How Many Times They Fuck, So Here We Are, Fu

  • censoredbig titssquirtingDHThot entertainmentyen ikkiDHT-246DHT24659dht00246
    • 2021-02-12
    81 min

    259LUXU-1379 Luxury TV 1365 Nasty! Outstanding proportions beauty likes the previous play and applies for re-appearance herself! Keeping the indecentness that captivates a man … The attitude of service that arouses the man’s heart is also w

  • amateur censoredamateurluxuluxu-1379luxu1379259luxu-1379
    • 2021-02-12
    152 min

    [MDBK-159]Super Closeup! Ultimate Tits Come Again And Again vol. 4

  • an sasakura yamamoto renka censoredbig titslingerieMDBKbazookataro kMDBK-159MDBK159h-1496mdbk00159
    • 2021-02-12
    143 min

    [ZMEN-079]This Lady Boss Had A Vibrator Installed In Her Pantyhose By Her Employee, And She Desperately Tried Not To Cum, But The Aphrodisiacs And Piston-Pounding Thrusts Got Her To Start Shaking Her Ass In Complete Orgasmic Capitulation

  • really aishin shinkawa censoredslutZMENz mengoro koenjiZMEN-079ZMEN079h-1371zmen00079
    • 2021-02-12
    119 min

    [DASD-813]Big Booty Boss Tempted By Her Coworker Into Submissive Sex Waka Misono Yu Shinoda

  • misono waka shinoda yu censoredslutdramaDASDdasrokusaburo mishimaDASD-813DASD813dasd00813
    • 2021-02-12
    205 min

    [BAZX-272](All POV) Nailing My Hot Receptionist vol. 001

  • aoi miu censoredcreampieuniformBAZXbazookatodoBAZX-272BAZX272h-1496bazx00272
    • 2021-02-12
    240 min

    IDBD-836 Give It Everything You've Got! Girls Cum Their Hardest For Explosive Fucks In (Holes On Fire) BEST Collection - A Compilation Of IP's Most Orgasmic Series Ever!

  • kana momonogi minami aizawa censoredsquirtingblowjobIDBDidea pocketidea pocket bestIDBD-836IDBD836idbd00836
    • 2021-02-12
    119 min

    [MIDE-881]Cutie With Soft, Curvy, Knock-Out Body Takes On Her First Client At A Soapland Brothel Rei Futami

  • rei futami censoredcreampieblowjobMIDEmoodyzsuisei akaimoodyz divaMIDE-881MIDE881mide00881
    • 2021-02-12
    160 min

    [IPX-612]Hot Female Teacher's Tryst With Her S*****t - Passionate Love-Making POV Footage Record Karen Kaede

  • karen kaede censoredblowjobsingle workIPXidea pocketzaku araidishIPX-612IPX612ipx00612
    • 2021-02-12
    119 min

    [DASD-811]My Sweet Girlfriend Got Bred By A No-Good Neighborhood Thug. Natsuki Mizuno

  • mizuno nagisa censoredcreampiesingle workDASDdasrokusaburo mishimaDASD-811DASD811dasd00811
    • 2021-02-12
    183 min

    [IPX-620]The Nasty Cowgirl Of An Older Sister Wearing Pantyhose - Minami Aizawa

  • minami aizawa censoredslutsingle workIPXidea pocketinaballdishIPX-620IPX620ipx00620
    • 2021-02-12
    64 min

    [DHT-245]Please Introduce Me To Someone Hornier Than You! 4 A Horny Bitch's Friend Has To Be A Horny Slut Too! Anyone Can Agree, These Girls Are The Sure Thing, Guaranteed To Be A Great Fuck, No Matter How Many Times They Fuck, So Here We Are, Fu

  • censoredbeautiful girlDHThot entertainmentyen ikkiDHT-245DHT24559dht00245
    • 2021-02-11
    121 min

    [FSDSS-170]Their Genes Want Each Other, Instinctual Fucking, Uncut Collection Ayaka Tomoda

  • ayaka tomoda censoredcreampiesquirtingFSDSSfalenopremium takanofaleno starFSDSS-170FSDSS1701fsdss00170
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-11
    38 min

    [ore-748]An

  • amateur censoredbig titsamateuroreore-748ore748ore-748
    • 2021-02-11
    38 min

    [ore-750]Renka

  • amateur censoredbig titsamateuroreore-750ore750ore-750
    • 2021-02-11
    115 min

    [FSDSS-172]Impatiently Begging: Super Horny Sex - Moe Tenshi

  • angel moe censoredblowjobsingle workFSDSSfalenoyamaguchi memberfaleno starFSDSS-172FSDSS1721fsdss00172
    • 2021-02-11
    38 min

    [ore-749]Ema

  • amateur censoredbig titsamateuroreore-749ore749ore-749
    • 2021-02-10
    22 min

    [SDFK-041]"Couples Only" Inside The Magic Mirror Number Bus, Let Your Beloved Girlfriend Get "Fucked" With Real Creampies! Rie-san (25 Years Old) Occupation: Massage Parlor Therapist

  • censoredSDFKsod createyoshiaki nomotomagic mirrorSDFK-041SDFK0411sdfk00041
    • 2021-02-10
    71 min

    259LUXU-1381 Luxury TV 1364 The glamorous body that was usually wrapped in a white coat will be unveiled tonight! True to the word that he asked for stimulation, the secret part covered with mysteriously overgrown pubic hair reacts sensitively to the

  • amateur censoredbig titsamateurluxuluxu-1381luxu1381259luxu-1381
    • 2021-02-09
    111 min

    241GAREA-497 Mai

  • amateur censoredamateurgareagarea-497garea497241garea-497
    • 2021-02-09
    481 min

    [MUCH-122]Girls With The Hottest Bodies Back-To-Back Sex With 10 Sizzlingly Sexy Babes Vol. 2 8 Hours, 2 Discs

  • konishi mika minako kirishima censoredbig titsbeautiful girlMUCHmothermuchi mutchiMUCH-122MUCH122h-796much00122
    • 2021-02-08
    73 min

    259LUXU-1380 Luxury TV 1363 A beautiful violinist is back! “I like him, but … I want to experience more with other men.” Dress in a bikini that accentuates the beauty slender style, and accept the big cock in the moist secret part, and

  • amateur censoredamateurluxuluxu-1380luxu1380259luxu-1380
    • 2021-02-08
    112 min

    460SPCY-014 [20 years old Hyogo Prefecture] Honoka

  • amateur censoredcreampieamateurspcyspcy-014spcy014460spcy-014



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi