censored nasty hard deepthroat




FC2MEYDNNPJLULUNATRMARADASDCESDSHKDVEMAFSDSSIPXBBANMILKHNDNACXHZGDHMNKSBJDASDNACR

2020-11-27
120 min

[DAVK-061]Losing Her Virginity With An HB Pencil! Daydreaming Y********l School Graduate With Zero Real Experience Has Her First Dick Experience With Middle-Aged Man! [Opening Her Pussy Wide Outdoors In The Middle Of The Day] - [Powerfully Squirting

  • censoredcreampieDAVKtmadoujin av clubDAVK-061DAVK06155davk00061
    • 2020-12-02
    54 min

    FC2PPV 1591303 [Appearance / Uncensored / Gachimono / If you like it] I was greedy and forced to conceive at the woman on top posture and vaginal cum shot and returned dirty

  • amateur uncensoredfc2
    • 2020-12-10
    53 min

    FC2PPV 1601468 [Complete appearance → It’s really dangerous if you get caught] Her friend boyfriend! The first 3P❤ G cup busty girl to argue! Cock-loving NTR reappears ❤ Paipan pussy G-spot Goryu Egu is raw ♪ First ever 4 consecutive vaginal cum

  • amateur uncensoredfc2
    • 2021-01-01
    178 min

    [DKSB-100]Rubbing Lesbian Pussies: Best Highlights

  • megumi shino ayumi takanashi censoredlesbianbeautiful girlDKSBoffice k sk s bestDKSB-100DKSB10036dksb00100
    • 2021-01-08
    190 min

    [GNAB-046]We Talk To Part-Time Staff At A Love Hotel! Will They Help Cherry Boys Jerk Off？ - They Spend All Day Cleaning Up After Other People Having Sex, Now It's Their Turn! - Their Loving Affection Gets The Guys Hard Immediately And They Let T

  • censoredamateurGNABprestigeelectric trainbang prestigeGNAB-046GNAB046118gnab00046
    • 2021-01-08
    240 min

    [SVDVD-834]The Magic Mirror Number Bus Hard Boiled What's In The Box？ If You Can Identify 3 Barely Legal Summer Girl Exhibitionist Babes Who Like To Show Off Their Skin, You Win 100,000 Yen! Take The Quiz Challenge!! She's Secretly Squeezing

  • censoredcreampiesquirtingSVDVDsadistic villagenew kage kazamamagic mirror number sadistic villageSVDVD-834SVDVD8341svdvd00834
    • 2021-01-14
    63 min

    H0930 ki210114 Hikari Kawanishi 28years old

  • amateur uncensoredh0930
    • 2021-01-21
    134 min

    [JRZE-024]First Time Filming My Affair Fumi Miyazawa

  • fumi miyazawa censoredcreampiemature womanJRZEcenter villagejiro fukagawajurakuJRZE-024JRZE024h-086jrze00024
    • 2021-01-23
    136 min

    [JUL-448]Gorgeous, Voluptuous Co-Stars! Your Sweaty Stepsisters Want To Share Their Colossal Tits With You And Take Your Creampie In A Three-Some Rin Okae Hana Haruna

  • rin okae haruna hana censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-448JUL448jul00448
    • 2021-01-24
    50 min

    FC2PPV 1657623 Yuka 21 years old A transcendental beauty who came to consult with a job hunting student! If you take off your suit, G cup big breasts and plump big ass! Creampie with seeds on the finest god-style body!

  • amateur uncensoredfc2
    • 2021-01-31
    65 min

    SIRO-4351 [First shot] [Idol who is shy] [When blamed for weaknesses ..] The back part-time job started by a super cute underground idol who can not live. Without knowing that the reaction of shame is reflected obscenely .. AV application on the net

  • amateur censoredamateursirosiro-4351siro4351siro-4351
    • 2021-02-10
    31 min

    FC2PPV 1680576 Limited to 3 days [Individual] In order to collect a large amount of debt, I rushed to the house and made another stick sucked in the mouth and drooled and made a large amount of vaginal cum shot

  • amateur uncensoredfc2
    • 2021-02-11
    77 min

    300MAAN-624 [Kalipi (Kali People) Girl, not Parisi! !! ] A cosplay bar clerk from Gunma participates in a guarantee drink! Ji Po’s corona attack with a thorough skill trained by him! !! “If everyone makes a squid with potash, put it all the

  • amateur censoredcreampieamateurmaanmaan-624maan624300maan-624
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-22
    70 min

    300MIUM-682 Ero Ero G cup beauty body wife! !! → [Beautiful young wife celebrity who manages her own beauty treatment salon! Sensitive slender BODY that sways and sways and blows tide during breasts and massage! !! ] × [The reality of an unfussy and

  • amateur censoredcreampiebig titsmiummium-682mium682300mium-682
    • 2021-02-23
    72 min

    200GANA-2444 Seriously Nampa, first shot. 1602 A fashionable celebrity married woman who suffers from sexlessness even though she is a newlywed found in Omotesando! Frustrated with having sex 3 months ago! The libido that was suppressed by stimuli ot

  • amateur censoredbig titsmarried womanganagana-2444gana2444200gana-2444
    • 2021-02-26
    186 min

    [DOCP-277]"Hey Big Stepbrother, Your Dick Gets Up Pretty Early In The Morning" Her Big Stepbrother Was A Late Sleeper, But His Morning Wood Was Up Early, And That Got Her So Excited, She Decided To Get A Little Taste! A Little-Stepsister-Blow

  • kawamura haru moe hazuki censoredbeautiful girlsisterDOCPprestigedocDOCP-277DOCP277118docp00277
    • 2021-03-06
    174 min

    [DVDMS-639]My First Girlfriend Got Her Brains Fucked Out By My DQN Classmate Fuckers. And I Never Even Got To Hold Her Hand ... Kasumi Tsukino

  • kasumi tsukino censoredbig titsbeautiful girlDVDMSdeepsgreen house effectdeep sDVDMS-639DVDMS639dvdms00639
    • 2021-03-06
    429 min

    [HSF-013]POV Sex Friends vol. 13

  • censoredcreampiecosplayHSFyou planningHSF-013HSF013189hsf00013
    • 2021-03-12
    92 min

    380SQB-092 Tsubasa

  • amateur censoredbig titsamateursqbsqb-092sqb092380sqb-092
    • 2021-03-18
    29 min

    FC2PPV 1731817 Super god style !! The boxed lady is interested and the first Gonzo in her life 2 shots ♡ Good personality and good style

  • amateur uncensoredfc2
    • 2021-04-02
    116 min

    [ATID-459]A Big Black Dick Is Fucking My Anus! Elly Akira

  • aki erie arai erie yuka osawa censoredmature womansingle workATIDattackerseitaro hagaein madATID-459ATID459atid00459
    • 2021-04-30
    36 min

    359TYVM-151 Plump Holstein Wife Big Breasts Yussa Yusa Creampie Sex! !!

  • amateur censoredcreampiebig titstyvmtyvm-151tyvm151359tyvm-151
    • 2021-05-14
    70 min

    [393OTIM-075]【妄想主観】いつでもどこでも即ハメOK！現役グラドルご奉仕メイド 天上みさ

  • amateur censoredcreampiebig titsotimotim-075otim075393otim-075
    • 2021-05-14
    119 min

    [PPPD-930]Extremely Sensitive Breasts!! Sex with You: Taking Some Aphrodisiacs And Giving An Indecent Raw Creampie At An Erotic Spa!! Miku Maina

  • maina miku censoredcreampiebig titsPPPDoppaiPPPD-930PPPD930pppd00930
    • 2021-05-19
    240 min

    [RVH-009]A Sexy P*A Director & A Mind-Blowing Female Teacher And A Bad Boy S*****t Council President Best Hits Collection vol. 2

  • otsuki sound nao mizuki censoredRVHglory questRVH-009RVH00913rvh00009
    • 2021-05-20
    122 min

    [JRZE-050]Entering The Biz At 50! Kaori Takamatsu

  • kaori takamatsu censoredcreampiemature womanJRZEcenter villagekotaro misatojurakuJRZE-050JRZE050h-086jrze00050
    • 2021-05-23
    66 min

    SIRO-4529 [First shot] [Arousing moist eyes] [Dirty erection nipples] A nursery teacher’s egg with a motherly smile makes her hidden sexual desire bloom. A nympho girl who seeks Chi Po with moist eyes pops the sexual desire accumulated in SEX fo

  • amateur censoredbig titsamateursirosiro-4529siro4529siro-4529
    • 2021-06-09
    69 min

    435MFC-113 [H-Cup Dynamite Body Beauty] Saffle and rich SEX with a smiley smile ♪ Ejaculation on the verge of ejaculation before inserting with an ugly tongue and the finest fucking! Squeeze sperm while going crazy with amazing tightening! !! Deep Yu

  • amateur censoredcreampiebig titsmfcmfc-113mfc113435mfc-113
    • 2021-06-22
    41 min

    FC2PPV 1882520 [No] [Limited to 100 pieces 2980 → OFF to 1480pt!] A certain fashion magazine reading mode finalist! Advent ♥ ️ I love naughty things! ♥ ️ * Review benefits / Sexy underwear masturbation

  • amateur uncensoredfc2
    • 2021-07-03
    60 min

    1Pondo 070321_001 Model Collection: Nana Nanami

  • amateur uncensored1pondo
    • 2021-07-09
    122 min

    [MUDR-153]No Groping. Complete Edition Minami Hatsukawa

  • hatsukawa minami censoredcreampiesingle workMUDRmukuMUDR-153MUDR153mudr00153
    • 2021-07-14
    119 min

    [PPPD-943]"I'm Telling You I Haven't Cum!" She Insists, But Her Body Is Twitching And She Just Squirted: Busty Agent Gets Caught And Cums Again And Again With Hot Piston Action - Kasumi Tsukino

  • kasumi tsukino censoredbig titssquirtingPPPDoppaiPPPD-943PPPD943pppd00943
    • 2021-08-06
    49 min

    FC2PPV 1960512 ★ 1,280pt Until 8/15 (Sun) For A Limited Time !! [No / Individual] Active Jd (21) With Strong Libido And Echi Echi Soft Body Gonzo ♪ Naked Y-Shaped Balance & Split Split To See The Dick! !! !! * High-Quality Review Benefits Availabl

  • amateur uncensoredfc2
    • 2021-08-06
    167 min

    [DASD-904]I Used To Look Up To My Bosses ... And When We Went On A Company Vacation, To My Surprise, They All Came To Fuck Me ... I Got Furiously Tantalized And Pumped Deep Down My Throat And My Pussy, Over And Over Again ... Mai Kagari

  • flower hunting censoredcreampiebeautiful girlDASDdaskindaichishougo rouDASD-904DASD904dasd00904
    • 2021-08-12
    127 min

    [SPRD-1444]Trying To Get Pregnant By My Father-In-Law And In Secret From My Husband, Violet Mihara

  • mihara sumire censoredmature womansingle workSPRDtakara eizouhotate ikkanaleddinSPRD-1444SPRD144418sprd01444
    • 2021-08-12
    56 min

    10musume 081221_01 An Office Lady With Outstanding Style Wear A Swimsuit Miki Inoue

  • amateur uncensored10musume
    • 2021-08-12
    147 min

    [HBAD-591]Newlywed Bride From The City Takes It All In Deep At Husband"s Rural Country Home. Kanna Hirai

  • shiori hirai censoredblowjobsingle workHBADhibinoumanami jirobabeHBAD-591HBAD5911hbad00591
    • 2021-08-21
    138 min

    [FLAV-278]HYPER FETISH High Leg Naughty Queen, Aoi Tojo

  • tojo censoredslutsingle workFLAVdigital arkdigital ark dejitarua kuFLAV-278FLAV278flav00278
    • 2021-09-01
    119 min

    [AMBI-135]Me And My Homeroom Teacher"s Secret Lovey-dovey Married Life - Yui Nagai

  • yui nagase censoredcreampieschoolgirlAMBIplanet plusdirector oanbibarentsuAMBI-135AMBI135h-237ambi00135
    • 2021-09-23
    49 min

    FC2PPV 2238344 Mysterious？ Natural Beauty Active Female College Student! Eh？ Raw Insertion In The Flow, Vaginal Cum Shot, Erotic Face Exposed With Continuous Cum On The Verge Of Fainting …

  • amateur uncensoredfc2
    • 2021-10-02
    87 min

    [USBA-035]Aphrodisiac BDSM Mind-Blowing Hellish Pleasure, Filled With Powerful Aphrodisiacs And Bukkake Aphrodisiac Breaking In Training File 13 Occupation: Office Lady Age: 24 Characteristics: Big Tits, Light Skin, And A Fierce Personality That She

  • riho fujimori censoredbig titssquirtingUSBAavskouri ba saburouavscollectorsUSBA-035USBA035usba00035
    • 2021-10-05
    64 min

    498DDH-038 [J ● Refre Voyeur] From The Moment I Met That Girl, My Big Tits Detector Started And My Heart Pounding Didn’t Stop! Good And Gentle, And Good At Recommending Options …! When I Was Struck By The Breasts And Continued To Provide Se

  • amateur censoredcreampiebig titsddhddh-038ddh038498ddh-038
    • 2021-10-08
    118 min

    [SSIS-207]Furious Follow-Up Piston-Pumping Strokes Until Her P*ssy Goes Insane! Sex With You, Fueled By Aphrodisiacs, To Pissing, Squirting, Dribbling Glory Kozue Fujita

  • kozue fujita censoredsquirtingsingle workSSISs1 no 1 stylemaeda bungouSSIS-207SSIS207ssis00207
    • 2021-10-15
    119 min

    [PRED-349]Seeing A C***dhood Friend During A Business Trip. We Needed More After A Night Out, So We Went Back To The Hotel To Party, Leading To Adultery And Non-stop Creampie Fucking. Yu Shinoda

  • shinoda yu censoredcreampiebig titsPREDpremiumakai suiseielegancePRED-349PRED349pred00349
    • 2021-11-06
    219 min

    [BAZX-315]Thick Sex With A Widow In Mourning Dress vol. 006

  • censoredcreampieBAZXk m producetodobazookaBAZX-315BAZX315bazx00315
    • 2021-11-13
    70 min

    355OPCYN-197 Urara (Kanon Urara)

  • amateur censoredcreampieamateuropcynopcyn-197opcyn197355opcyn-197
    • 2021-11-18
    126 min

    [KAAD-059]My Beautiful Mother-in-law, Reiko Seo

  • reiko seo censoredcreampiemarried womanKAADcenter villageshibuyahanazono center villageKAAD-059KAAD059h-086kaad00059
    • 2021-11-19
    173 min

    [ROYD-074]My Gentle and Cute C***dhood Friend Spoils Me By S******g With Depressed Me. Karen Asahina

  • karen asahina censoredbeautiful girlsingle workROYDroyalmorikihhh groupROYD-074ROYD074royd00074
    • 2021-12-01
    133 min

    [NACR-483]Beautiful Daddy"s Girl Loves To Have Nipples Teased And Body Caressed!! Reona Tomiyasu

  • takehiro tomiyasu censoredcreampiebig titsNACRplanet plushimu locknanakuruNACR-483NACR483h-237nacr00483
    • 2021-12-19
    37 min

    FC2PPV 2526936 [Uncensored] The Highest Style! I Was Able To Spend A Rich Time With The Glamorous Beauty Of The Estimated G Cup (Impressive) Really The Best Vaginal Cum Shot (Crying)

  • amateur uncensoredfc2
    • 2021-12-25
    119 min

    [BSTC-061]たわわなIカップ爆乳若妻 他人棒との快楽に溺れ豊満ボディを弄ばれイキ果てる！！

  • censoredcreampiebig titsBSTCboston clubBSTC-061BSTC061h-1117bstc00061
    • 2022-01-01
    40 min

    210AKO-450 AYANE (Ayane Suzukawa)

  • amateur censoredamateurlingerieakoako-450ako450210ako-450
    • 2022-01-13
    108 min

    [SPRD-1503]My Son-In-Law. The Son-In-Law, Who Has Strong Sexual Desires, Falls Madly In Love With His Mother-In-Law. Akari Maya.

  • shinya akari censoredmature womansingle workSPRDtakara eizosanpei suminekoaleddinSPRD-1503SPRD150318sprd01503
    • 2022-01-14
    148 min

    [EBOD-885]Step-grandchild That Didn"t Know The First Thing About Sex Is Oblivious About Her Big Tits And The Temptation They Stir Up, So Her Step-grandfather Gives Her A Thorough Lesson In Pleasure When She Visits For Summer Vacation. Aria Oshima

  • aria oshima censoredbig titsbeautiful girlEBODe bodytrendy yamaguchiEBOD-885EBOD885ebod00885
    • 2022-01-22
    131 min

    [ONSG-048]Call Girl With Big Tits. Miki Shiraishi

  • miki shiraishi censoredcreampiebig titsONSGgain corporationONSG-048ONSG048onsg00048



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi