censored variety cheating wife javcensored married woman




FC2MEYDNGODHDKAHZGDDASDVEMACESDSQTEPREDPPPDNACRKBIWAAAJULCJODDASDAMBIGMEMMARARBD

2020-09-25
240 min

[SCPX-406]Erotic Aroma Drives Girls Wild! A Sensual Oil Massage! Non-Stop G-Spot Stimulation Leaves Them Begging! "Please Let Me Cum... I'll Do Anything!" Incredible Orgasms Bring Them To The Brink, Writhing With Ecstasy! Dripping Wet Pus

  • censoredcreampieblowjobSCPXscooptodomousouzokuSCPX-406SCPX406h-565scpx00406
    • 2020-09-28
    53 min

    FC2PPV 1516785 [Personal shooting] Imadoki sister with beautiful nails If you take off, fair-skinned marshmallow boobs! Raw vaginal cum shot in a gentle small pussy!

  • amateur uncensoredfc2
    • 2020-09-28
    54 min

    [DHT-170]Reiko Kobayakawa Will Gently And Relentlessly Make You Cum A Cherry Boy Popping Documentary

  • censoredbig titsmature womanDHThot entertainmentkazuki madokaDHT-170DHT17059dht00170
    • 2020-10-02
    302 min

    [HEZ-217]Real Amateur Love Connection Project: Can We Get You The Co-worker You Like？ We'll Stick Our Nose In Your Business So We Can Film You Sticking It In Each Other on Hidden Camera! 10

  • censoredcreampiebig titsHEZhot entertainmentkazuki enenHEZ-217HEZ21759hez00217
    • 2020-10-02
    53 min

    [EMOI-016]An Emo Girl/A Four-Legged Walk On A Leash/A Threesome Skewering Fuck/A Deep Throat Blowjob/A Gal With A Dark Character/Rina Hinata (22)

  • hyuga rina censoredamateurbeautiful girlEMOIsod createtakuanemotional girlEMOI-016EMOI0161emoi00016
    • 2020-10-15
    63 min

    [SIROR-032]The Work Of A Mature Woman For Rent - The Side Of A Wife That A Husband Does Not Know, file NO.32 -

  • censoredcreampiebig titsSIRORamateur dispatch.comSIROR-032SIROR032h-1492siror00032
    • 2020-10-16
    235 min

    [DOCP-254]I Mistook Her For My Girlfriend... I Plunged My Raw Cock Into My Girlfriend's Little Sister And Had An Insta Fuck! But It Felt So Good I Just Kept It In There For A Creampie Orgasm... And Then That Flipped Her Switch And Now She Was Rea

  • yuri fukada nanami sena censoredcreampiebeautiful girlDOCPprestigedoc premiumDOCP-254DOCP254118docp00254
    • 2020-10-16
    240 min

    [MBM-219]First-Time Customers Welcome! This Horny Housewife Is Going Viral For Adultery Creampie Sex Into A Horny Wife's Pussy Who Has A Very Low Threshold For Sex 12 Ladies 4-Hour Special 4

  • censoredcreampieamateurMBMprestigegaro sasazukambmMBM-219MBM219118mbm00219
    • 2020-10-23
    246 min

    [ENKI-030]Arisu: A Slut So Wild She'll Blow Your Mind With Her Bareback, Breeding Sex - Ultra Sensitive Pussy, No Holds Barred Creampie G*******g

  • censoredcreampiedeepthroatENKItoxic bacchanalENKI-030ENKI030h-1406enki00030
    • 2020-10-30
    243 min

    [EQ-533]Secretly Being Mischievous Under The Table, "Hey!？ My Boyfriend Will Notice!" Serious Sex After Being Taken By My Boyfriend's Friend! 4 Hours SP

  • censoredcreampiebig titsEQbullitterotic touchingEQ-533EQ533h-100eq00533
    • 2020-11-05
    58 min

    345SIMM-546 Ayumi / 18 years old / Outdoor Iki Girls ● Raw

  • amateur censoredcreampieuniformsimmsimm-546simm546345simm-546
    • 2020-11-06
    46 min

    [SHYN-130]SOD Female Employees - We Challenge Them With Strip Rock-Paper-Scissors On Their Day Off! The Executive Section's Miki Komatsu

  • miki komatsu censoredbeautiful girlSHYNsod createy 10432sod female employeeSHYN-130SHYN1301shyn00130
    • 2020-11-07
    241 min

    [PKPD-120]Pay-For-Play Sex Highlights Creampie Sex: OK 18 Years Old A Pay-For-Play J* 240 Minutes

  • scooping kanon kanon censoredschoolgirlbeautiful girlPKPDfuck group and fun friends daydreamersPKPD-120PKPD120pkpd00120
    • 2020-11-08
    62 min

    [orex-170]もえちゃん 2

  • amateur censoredcreampieschoolgirlorexorex-170orex170orex-170
    • 2020-11-15
    76 min

    300NTK-468 Erotic champion-class exquisite body beauty OL! !! Approval desire Egg Egg’s harsh heart & breasts are also stimulated and Gachi wet SEX is also taken! !! Kickboxing-polished tightening World-class good Ma ○ Ko with no gloves Chi

  • amateur censoredcreampieamateurntkntk-468ntk468300ntk-468
    • 2020-11-18
    240 min

    [RVH-006]A Sexy P*A Director & A Mind-Blowing Female Teacher And A Bad Boy S*****t Council President Best Hits Collection vol. 1

  • hitomi enjo gloss hall shiori endo bookmark censoredRVHglory questRVH-006RVH00613rvh00006
    • 2020-12-01
    77 min

    [MBRAZ-028]川口彩夏 恋してシースルー

  • kawaguchi ayaka censoredMBRAZspice visualblue ribonMBRAZ-028MBRAZ028406mbraz00028
    • 2020-12-11
    78 min

    300MAAN-608 [Advent to drink a beautiful breast beauty gala with 100 transparency] Outstanding proportions on the baby face! A date to enjoy Yokohama with a cute and graceful beauty with a smile → Gala drinking 3P sex night ♪ The true identity of a c

  • amateur censoredcreampieamateurmaanmaan-608maan608300maan-608
    • 2020-12-25
    35 min

    FC2PPV 1620264 * Uncensored * ★ Spanish active model ★ BOF limited Rose-chan A passion covered with slimy oil F 〇 CK prat2 ♡

  • amateur uncensoredfc2
    • 2021-01-04
    120 min

    [C-2604]Raw Footage Lesbian Series Hot Springs Trip 12

  • censoredCgogosgogo s coreC-2604C2604140c02604
    • 2021-01-17
    111 min

    [MKD-221]An Ass So Fine You'll Sigh Over It! MILF In Her Forties With Pure Pale Skin And Hard Nipples Makes Her Porn Debut! Shigure Maya

  • maya shigure censoredmature womansingle workMKDrubymaterukazu umiyamaMKD-221MKD221mkd00221
    • 2021-01-30
    149 min

    [MMND-194]Active Gravure Idol With Issues: "No Way I Can Do Porn" Kanako (alias) Gets Her Trademark Colossal G-Cup Tits Thoroughly Fondled

  • censoredbig titsMMNDmimanyuki iwasawaMMND-194MMND194mmnd00194
    • 2021-02-16
    132 min

    [KMHRS-039]Product Name: Colorless, Transparent Natural Juices From Unspecified Girl - Contents: Sweat, Pussy Juices, Spit, Cum, Piss - Misuzu Miyamori

  • misuzu miyamori censoredsquirtingamateurKMHRSsod creatememe akiyamakimihoreKMHRS-039KMHRS0391kmhrs00039
    • 2021-02-16
    138 min

    [KIRE-025]This Forty-Something Babe Is Spasmically Orgasming And Trembling Like A Newborn Deer!! 36 Orgasms! 3 Orgasmic Fucks! This Naive Mature Woman Is Getting Her Pussy Worked Over!! Miki Mori 40 Years Old

  • miki mori censoredmature womansingle workKIREsod createryo inugamibeauty kirei sodKIRE-025KIRE0251kire00025
    • 2021-02-17
    93 min

    SWEET-051 Mizuzu

  • amateur censoredschoolgirlamateursweetsweet-051sweet051sweet-051
    • 2021-02-26
    47 min

    FC2PPV 1702015 Until 3/4 980 [No] #Hidden busty Necafe refugee brought into the room and vaginal cum shot

  • amateur uncensoredfc2
    • 2021-03-02
    56 min

    345SIMM-614 Big butt bullet cowgirl that defenseless character can not be alert

  • amateur censoredcreampieuniformsimmsimm-614simm614345simm-614
    • 2021-03-06
    44 min

    10musume 030621_01 Walking With Remote Rotor: It feels so good I can’t walk anymore Akane Maruyama

  • amateur uncensored10musume
    • 2021-03-11
    158 min

    [MIST-329]Ovulation Day Special! This Delivery Maid Is Ready To Be Impregnated Erina Oka

  • hill erina censoredcosplayMISTmr michirusaitaMIST-329MIST3291mist00329
    • 2021-03-14
    49 min

    492MERC-268 Countryside Chari Girls ○ Raw

  • amateur censoreduniformschoolgirlmercmerc-268merc268492merc-268
    • 2021-03-18
    88 min

    [REBD-543]Ai A Goddess With Huge Tits - When A Man's Dreams Cum True - Ai Kano

  • ai kano censoredsingle workREBDrebeccachikara sawamuraREBD-543REBD543h-346rebd00543
    • 2021-04-12
    242 min

    [MCSO-008]A Special Oil Massage Creampie Fuck, Spiked With Aphrodisiacs I Furiously Pounded Her Pussy With Piston-Pumping Intensity Until She Twitched And TremB**d With Orgasmic Pleasure Best Hits Collection 4 Hours

  • censoredcreampiebig titsMCSOmercurypremier dreamMCSO-008MCSO008h-1133mcso00008
    • 2021-04-15
    88 min

    [SUJI-133]This ** S*****t Was Ravaged By The Desires Of Men Creampie Raw Footage Mao

  • censoredcreampiebeautiful girlSUJIkanranshaSUJI-133SUJI133suji00133
    • 2021-04-15
    122 min

    [ZEX-403]*Warning* To The Brink Of Breaking! Super Intense Begging For Climax Sex Hono Wakamiya

  • honoka wakamiya censoredbig titssingle workZEXpeters maxZEX-403ZEX403h-720zex00403
    • 2021-04-15
    60 min

    FCP-012 [Delivery only] "What did you do？ you can not sleep？ I’ll do something comfortable and let you lie down … ”Ultimate healing erotic! Co-sleeping handjob! !! ＃ 3

  • amateur censoredbig titsamateurfcpfcp-012fcp012fcp-012
    • 2021-04-19
    20 min

    FC2PPV 1777111 2800pt → 1200pt [Individual shooting, 3P second half] Seriously covered with pregnancy juice without any help to the violently rampaging meat stick! Two strange sticks are inserted many times that the husband has never done, and finall

  • amateur uncensoredfc2
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-07
    150 min

    [MEYD-677]A Son's Wife Just Can't Resist Her Father-In-Law's Seduction - She Acts Like She Doesn't Want It, But She Keeps Cumming For More Yu Shinoda

  • shinoda yu censoredcreampiesingle workMEYDtameike goroMEYD-677MEYD677meyd00677
    • 2021-06-04
    157 min

    [NKKD-210]These Couples Missed The Last Train So They Spend The Night Together! - They Just Happened To Be Going In The Same Direction, But They End Up Sharing More Than Just A Taxi! 11

  • censoredNKKDjet eizomanji groupNKKD-210NKKD210nkkd00210
    • 2021-07-03
    151 min

    [URKK-041]Live-In Lifestyle With My I-Cup Step-Cousins: The Temptation Of Their Colossal Tits - Titty Fucks, Dual Creampie

  • tomoko kamisaka yukino nagi censoredbig titssisterURKKunfinishedrolanda familiar breastURKK-041URKK041urkk00041
    • 2021-07-03
    47 min

    C0930 hitozuma1358 Yuika Yoshikata 26years old

  • amateur uncensoredc0930
    • 2021-07-08
    124 min

    [RCTD-412]Eyeglasses That Turn You Into A Woman. Nenne Ui.

  • first love censoredbig titsschoolgirlRCTDrocketroot yamazakiRCTD-412RCTD4121rctd00412
    • 2021-07-15
    119 min

    [JUAN-004]Sumire Shiratori 's Retirement Work! A MILF Stepmother Who Lifts Her Ban on Anal Sex for the Sake of Her Stepson

  • shiratori shiratori censoredanalmature womanJUANrubysuke kato 6lust rubyJUAN-004JUAN004juan00004
    • 2021-07-15
    21 min

    HEYZO 2567 Mari’s Amazing Hand Job – Mari Koizumi

  • mari koizumi uncensoredhandjobcumshotheyzo
    • 2021-07-24
    117 min

    [OMT-022]Hカップお宝パイのむっちり柔肉女子はド淫乱で貪欲なオヤジチ●ポ喰い女だった！ 美園和花

  • misono waka censoredbig titscosplayOMToyster kaiunOMT-022OMT022h-1359omt00022
    • 2021-07-30
    120 min

    [JUL-672]My Husband Cannot Satisfy Me...The Married Woman Who Fell For The Well-Endowed Shop Manager At Her Part-Time Job. Nao Jinguji.

  • jinguji temple nao censoredmature womansingle workJULmadonnakitorune kawaguchiJUL-672JUL672jul00672
    • 2021-08-24
    72 min

    200GANA-2540 Seriously Nampa, First Shot. 1681 [Squirting That Doesn’T Stop! Cum That Doesn’T Stop! ] Super Dirty Little Yang Ca Gal Leaked By Self-Irama! The Finest Body With A Rippling Big Butt! Look At The Worrisome Excitement! !!

  • amateur censoredbig titssquirtingganagana-2540gana2540200gana-2540
    • 2021-08-28
    240 min

    [JKSR-507]We"ll Film POV Videos Of Local Amateur Housewives 22 Loose Wives From The Kansai Region 4 Hours

  • censoredcreampiemarried womanJKSRbig mocalobockeypink junkieJKSR-507JKSR50757jksr00507
    • 2021-09-09
    82 min

    [IENF-164]"Is It Bad That My First-time Partner Is Lewd Like Me？" You"re A Cherry Boy If You Confess Your Feelings For An Exceptionally Lewd Classmate？ Let"s Give It A Shot First! Her Naive Demeanor Is A Change From Normal, But It Mak

  • himari ayase niko nekomura censoredcreampieslutIENFienergytiger kosakaiienfIENF-164IENF1641ienf00164
    • 2021-09-17
    30 min

    FC2PPV 2212749 * Super Deals Limited To Consecutive Holidays 980 Yen! * 19-Year-Old [Shimbashi_hospital Receptionist] Cosplay Student Support 〇

  • amateur uncensoredfc2
    • 2021-10-15
    122 min

    [PRED-348]"Sir, How Would You Like To Cum Today ...？" This Plain Jane Female Employee Made Abnormal Love To Me That Day, And Satisfied Her Lust, And Creampie Fucked Me To Oblivion. Runa Tsukino

  • tsukino luna censoredcreampieblowjobPREDpremiumeightelegancePRED-348PRED348pred00348
    • 2021-11-05
    119 min

    [DASD-934]Lubricated Slender Step-Sisters Rub Big Tits With Lotion Lovingly To Tempt Father-in-law Yu Shinoda Yuria Hakaze

  • shinoda yu yuria hafu censoredbig titsDASDdasmishima rokusaburoDASD-934DASD934dasd00934
    • 2021-11-06
    128 min

    [CEMD-079]Perfectly Sensitive! 4 Lesbians With Tiny Tits! Hikaru Minazuki, Kurumi Suzuka, Karen Kyowa, Shizuka Hanai. These Girls Get Their Perfectly Sensitive Little Tits Together For Hot Teasing!

  • hikaru minazuki suzuka walnut censoredlesbianmature womanCEMDserebu no tomoCEMD-079CEMD079cemd00079
    • 2021-11-09
    37 min

    C0930 ki211109 Noriko Ichikawa 44years old

  • amateur uncensoredc0930
    • 2021-12-30
    107 min

    [IRO-047]Lewd Groping Train For Married Women. A Woman In Her 50s Gets Touched. Miyako Hori

  • hori miyako censoredcreampiesingle workIROcenter villagedaichi minamizegu center villageIRO-047IRO047h-086iro00047
    • 2022-01-08
    168 min

    [CEMD-113]Seductive Housemaid In A Thong! 2 Kokona Asakura ~ G-Cup Housemaid Seduces Men With Her Slutty Thong

  • asakura here censoredcreampiebig titsCEMDceleb no tomoCEMD-113CEMD113cemd00113



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi