compilation javcensored over hours mature woman censored




FC2NNPJJULIPXHODVNACXNATRGVHAWDMARAHDKACAWDSPRDCHRVRBDSQTEAVSASSNIONEZAMBIAUKG

2020-10-22
93 min

[OKB-098]Himari Misono, A. Godly Bloomer With A Bubbly Ass. Super Close-up Shots Of Cameltoes And Wet Clothes Allowing You To See The Curves Of Beautiful Chubby Lolitas Wearing Gym Clothes! This Is An AV For Fetishists Of Fully Clothed Girls, Where B

  • misono himari censoredschoolgirlsingle workOKBdaddy s private photosgoddess in bloomersOKB-098OKB0981okb00098
    • 2020-10-27
    58 min

    345SIMM-539 Midori-chan / 18 years old / Icharab Incest Girls ● Raw

  • amateur censoredcreampieuniformsimmsimm-539simm539345simm-539
    • 2020-11-06
    161 min

    [ABW-022]Gorgeous Girl's Amazing Escort Sex - She Seduces A Younger Amateur Guy Body And Soul With Wild Sex Airi Suzumura

  • suzumura airi censoreddeepthroatsingle workABWprestigepunonpen ryouabsolutely wonderfulABW-022ABW022118abw00022
    • 2020-11-19
    87 min

    [REBD-511]Ibuki Mischief Sweet Sister - Ibuki Aoi

  • aoi ibuki censoredsingle workREBDrebeccachikara sawamuraREBD-511REBD511h-346rebd00511
    • 2020-11-27
    100 min

    [YSN-531]Hellish Thrusts Thrusting Into My Younger Step-sister's Throat Every Hour Of The Day - Kotone Fuyuai

  • toua kotone censoredcreampieYSNnonYSN-531YSN531h-127ysn00531
    • 2020-11-29
    139 min

    [NKD-264]An Anal Journal Rei Hanamiya

  • rei hanamiya censoredanaldeepthroatNKDnakajima kogyofubuki sakuraNKD-264NKD264nkd00264
    • 2020-12-11
    126 min

    [REAL-753]Relentlessly Making Her Cum - Kaho Imai

  • natsuho imai censoreddeepthroatsingle workREALreal workskaorureal real worksREAL-753REAL753172real00753
    • 2020-12-17
    170 min

    [ROYD-035]I Woke Up In The Morning To Find My Stepsister On My Futon! "I Want Your Cock..." She Said, And Pressed Her Nipples Into My Back. Riho Fujimori

  • riho fujimori censoredblowjobsisterROYDroyalkawajirihhh groupROYD-035ROYD035royd00035
    • 2020-12-27
    57 min

    C0930 ki201229 Natsue Yukawa 31years old

  • amateur uncensoredc0930
    • 2020-12-28
    54 min

    FC2PPV 1612940 Mosaic collapsed version ❤️ A hostess who goes crazy with abstinence for 2 weeks is seriously dying of sexual desire ❤️ A bitch who sucks on her husband’s Ji ○ port with an ahegao

  • amateur uncensoredfc2
    • 2021-01-19
    96 min

    [SDDE-640]Remote Control Pussy: Splice This DNA Into The Girl Of Your Dreams And Take Control Of Her Sex Life! Classmates, Female Teachers, Stepsisters - You Name Them, You Can Fuck Them!

  • ichika matsumoto manami oura censoredschoolgirlsisterSDDEsod creatememe akiyamasenzSDDE-640SDDE6401sdde00640
    • 2021-01-22
    79 min

    [SS-012]STAY GOLD AIKA

  • anmizuki kaori makise censoredbig titsSSfine picturesshooting star fine picturesSS-012SS01213ss00012
    • 2021-01-25
    60 min

    FC2PPV 1659367 ☆ First shot ☆ “I really like naughty ♥” I was told that I shouldn’t put it in the sober and mature JD and raw SEX ♥ who came to Tokyo from the countryside … Oh, maybe it leaked a little w [With benefits] ]

  • amateur uncensoredfc2
    • 2021-01-25
    49 min

    IDJS-037 Yuriko

  • amateur censoredcreampiebig titsidjsidjs-037idjs037idjs-037
    • 2021-01-29
    301 min

    [SUPA-565]謹賀新年！！今年もたくさんヌかせます！！美女詰め合わせSS級福袋！！2021年お年玉ベスト

  • censoredcreampiebig titsSUPAs kyuu shiroutok tarouSUPA-565SUPA565h-244supa00565
    • 2021-01-29
    120 min

    [NEM-052]Stepmom's Ass Pull Out In Full View: Family Fun 1 Chisato Shoda

  • shota chisato censoredcreampiebig titsNEMglobal media entertainmentkikujiro akabanenewmomNEM-052NEM052143nem00052
    • 2021-01-30
    149 min

    [MIAA-380]Busty Wife Gets Fucked By Her Husband`s Hated Boss All Over Again Hikari Sena

  • hikari sena censoredcreampiesingle workMIAAmoodyzzaku araieveryone s porn starMIAA-380MIAA380miaa00380
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    112 min

    [XRW-975]This Cum Bucket Beautiful Girl Is Fully On Board With Fucking Creepy Old Men, Because That's The Only Kind Of Man She Can Love Akane It Doesn't Matter If She's Having Sex With A Creepy, Dirty Old Stranger, Even If She Gets Rich A

  • censoredbeautiful girlslutXRWreal workshirapireal real worksXRW-975XRW975172xrw00975
    • 2021-02-12
    109 min

    [GGEN-010](Real Sexy Escapes - Spin Off) If You Don't Have Anal Sex, The Door Won't Open...

  • nanako takamiya mihina azumihina mihina nagai censoredGGENprestige3 jigen mimanGGEN-010GGEN010118ggen00010
    • 2021-02-12
    208 min

    [BAZX-273]喪服未亡人と濃厚性交。Vol.002

  • censoredcreampieamateurBAZXbazookatodoBAZX-273BAZX273h-1496bazx00273
    • 2021-02-20
    51 min

    491TKWA-158 The talented J ○ who is studying in the library shifts the pants and exposes the pussy and presses for SEX! Of course, without refusing, the last is vaginal cum shot!

  • amateur censoredcreampieuniformtkwatkwa-158tkwa158491tkwa-158
    • 2021-02-20
    75 min

    FC2PPV 1693868 [No individual shooting, I can only see it here, but lewd mature woman leaked w] I have not heard! I hate it! I made a former Yan Mama beautiful mature woman attack a subordinate of a big cock w But w I got caught in front of a big dic

  • amateur uncensoredfc2
    • 2021-02-22
    84 min

    [MCKT-016]Hot Girls Who Love To Party! Girls Pick Up Guys To Fuck On The Street Corner Hibiki Otsuki

  • otsuki sound censoredcreampieMCKTchikikikikama delusion groupMCKT-016MCKT016mckt00016
    • 2021-02-24
    64 min

    FC2PPV 1700163 [1st Anniversary & 10,000 Comments Thanks] First Shooting & G Cup (100cm) Former S Idol is inexperienced and has 5 consecutive cum swallowing circle 10 Miyuki

  • amateur uncensoredfc2
    • 2021-02-25
    227 min

    [NHDTB-495]A Lesbian Massage Parlor That Will Directly Target Female G-Spots They'll Develop These Undeveloped Bodies Through Nipple Tweaking And Teasing Until They Can No Longer Resist Their Orgasmic Pleasure

  • censoredsquirtinglesbianNHDTBnatural highvanilla sakuraiNHDTB-495NHDTB4951nhdtb00495
    • 2021-03-02
    87 min

    261ARA-478 [Extremely erotic BODY if you take it off] 24 years old [Miracle G cup beauty big breasts] This is coming! The reason for her application that she will appear on AV on the way home from work is “Masturbation is not enough …”

  • amateur censoredbig titsamateuraraara-478ara478261ara-478
    • 2021-03-03
    61 min

    FC2PPV 1710343 PREMIERE ＃ 5 or ◯ -chan and birthday dating

  • amateur uncensoredfc2
    • 2021-03-12
    35 min

    FC2PPV 1722707 [No first shot vaginal cum shot] 140 minutes suddenly 2 packs Sober Loriko is a 20-year-old claw I tried to vaginal cum shot to that child who was an adult in the class w [Personal shooting]

  • amateur uncensoredfc2
    • 2021-04-03
    117 min

    [BKD-260]Stepmother/Stepson Fucking (The Nasu Sabi River Road) Yurika Aoi

  • yurika censoredmature womansingle workBKDrubyhiroyuki kimuratobijiBKD-260BKD260bkd00260
    • 2021-04-09
    130 min

    [MUKC-016]Squirting Nanase Asahina Asahina Nanase

  • asahina nanase censoredcreampiesquirtingMUKCmukuinnocent cosplayMUKC-016MUKC016mukc00016
    • 2021-05-26
    123 min

    [GS-2016]True Stories: Family Fun [49]

  • niwa sumire censoredGSgoskoichi takahashiGS-2016GS2016
    • 2021-06-05
    121 min

    [SCD-194]Emi Toda Is A MILF Celebrating Her 60th Birthday By Giving Me An Erection Capsule

  • emi toda censoredmature womanslutSCDrubyscoopSCD-194SCD194scd00194
    • 2021-06-11
    75 min

    FC2PPV 1862876 [No first shot appearance] A god work that will never regret !! Day 3 in Tokyo Neat and clean extreme maiden Tin 18 years old 70 minutes for the first time [Personal shooting]

  • amateur uncensoredfc2
    • 2021-06-16
    217 min

    [HUNTB-038]"Hey Big Stepsister, What Are You Doing!？" When I Came To, My Big Stepsister Was Riding My Cherry Boy Cock, And Cumming Over And Over Again! My Super Excessively Protective Big Stepsister Has A Warped Sense Of Love, But That's

  • censoredcreampiesisterHUNTBhuntervolvo nakanohhh groupHUNTB-038HUNTB038huntb00038
    • 2021-06-17
    69 min

    200GANA-2506 Seriously Nampa, first shot. 1649 Pretending to be a neat music college student who aspires to be a music teacher and picking up! Although I am confused by the erotic story, if I give a flickering reward, I will be swept away and open my

  • amateur censoredbig titsamateurganagana-2506gana2506200gana-2506
    • 2021-07-03
    140 min

    [PKPT-001]Studio Apartment Documentary Making Love All Day In A Small Room With K-Cup Hana Haruna

  • haruna hana censoredcreampiebig titsPKPTfuck group and fun friends daydreamersPKPT-001PKPT001pkpt00001
    • 2021-07-03
    97 min

    [VENX-053]She Can't Live Without Her Stepson Anymore... 50 Orgasms Push This Horny Stepmom To Her Upper Limit With Creampie Sex Yuna Kitano

  • yuna kitano censoredcreampiemature womanVENXvenusmajime kitanofakecest winntersVENX-053VENX053venx00053
    • 2021-07-10
    195 min

    [TPIN-006]Amateur Bouncing Boobs TV H Cup Nurse Mei (25) Single

  • censoredbig titsnurseTPINchinpoinTPIN-006TPIN006tpin00006
    • 2021-07-24
    145 min

    [JKSR-502][Leaked Images] Girls at Training Camps for their Clubs in Sex, Sucking, 3P, Voyeurism While Changing...Many other Horny Videos.

  • censoredschoolgirlamateurJKSRbig morkalprink junkyJKSR-502JKSR50257jksr00502
    • 2021-08-20
    120 min

    [JUL-684]Close-up Sex - A Yoga Instructor Who Falls Into Unfaithful Creampies With Her S*****t - Sakuraka Mizuki

  • sakuraka mizuki censoredcreampiemature womanJULmadonnamishima rokusaburoJUL-684JUL684jul00684
    • 2021-08-20
    240 min

    [REXD-379]Sanctions Against The Self-Important Woman: My Dick! "Wow...It"s This Effective..."

  • censoredcreampieREXDreddogroupREXD-379REXD379rexd00379
    • 2021-09-10
    218 min

    [HUNTB-088]"I"ll Be Sure To Jerk You Off Nice And Slow!" "Uh-Oh, Are You Going To Cum？" "Hey! I Said Not Yet!" A Serious Study Session Turns Into A Fuck Session!

  • censoredcreampieblowjobHUNTBhunterkoichi davidsonhhh groupHUNTB-088HUNTB088huntb00088
    • 2021-09-24
    101 min

    [YST-256]Vulgar Or Not, I Want To Play With Nagisa Like Crazy Mitsuki Nagisa

  • scooping censoredcreampiesingle workYSTkoyachoYST-256YST256540yst00256
    • 2021-10-01
    61 min

    326GCP-012 Slutty Amateur 100! A Female College Student Awakens A Slut In A Bad Man Correction Project! !! !! Charity Slap, Strangling Cowgirl Etc … Gently Defeat Non-Motivated Boys! !! (Mizuki Yayoi)

  • amateur censoredbig titsamateurgcpgcp-012gcp012326gcp-012
    • 2021-10-15
    148 min

    [MVSD-483]This Hot Blowjob Slut Comes In Quick To Give A Dick Plenty Of Sucking! Haru Yamaguchi

  • yoko yamaguchi censoredschoolgirlblowjobMVSDm s video groupms video groupMVSD-483MVSD483mvsd00483
    • 2021-10-23
    236 min

    [OKAX-786]Horny Wives Masturbation Sessions - 30 Girls, 4 Hours - Vibrator And Finger Fun For Pussies And Clits - Enjoy The View Of Their Very Own Special Private Time

  • censoredOKAXk m produceoomei jirouokazuOKAX-786OKAX786okax00786
    • 2021-10-26
    59 min

    10musume 102621_01 The School Uniform: I’m Excited To See Av Three Or Four Times A Week Kokomi Date

  • amateur uncensored10musume
    • 2021-11-11
    97 min

    DCH-017 Sari (Sara Uruki)

  • amateur censoredamateurbeautiful girldchdch-017dch017dch-017
    • 2021-11-12
    239 min

    [SKMJ-226]A Beautiful Amateur Girl Is Doing Housekeeping At A Man"s House. I"m Not Going To Stop Even If She Comes.

  • censoredcreampieamateurSKMJblush girlyosukeSKMJ-226SKMJ226h-1324skmj00226
    • 2021-11-27
    122 min

    [ITSR-098]Milf Gets Serious. "Stop The Teasing" She Says With A Laugh At First, But It Gets Real With A Signal To Full-on Sex! This Milf Gets A Serious Creampie At The End!？ - 8. Misato-san (48), Shitara-san (49)

  • censoredcreampieamateurITSRbigmorkalmaxchou itadakiITSR-098ITSR09857itsr00098
    • 2021-12-02
    125 min

    [AARM-040]She Gazes At You And Gives You A Gentle Handjob, Talking Dirty At Such Close Range That Her Lips Are Almost Touching Yours 2

  • kuraki bookmark chiharu miyazawa censoredsluthandjobAARMaroma planningsatoshimaaromaAARM-040AARM040aarm00040
    • 2021-12-07
    80 min

    230OREC-952 Chiharu-San (Chiharu Miyazawa)

  • amateur censoredcreampieamateurorecorec-952orec952230orec-952
    • 2021-12-17
    205 min

    [HJMO-481]Husband And Wife Challenge! When The Husband Is Made To Cum Twice By Minami Hatsukawa"s Amazing Technique, The Wife Is Cuckolded And Has Sex In The Middle Of The Night!

  • hatsukawa minami censoredcreampiebig titsHJMOhajime kikakuHJMO-481HJMO481hjmo00481
    • 2021-12-23
    139 min

    [IENF-183]Ena Satsuki. A Top Class Beautiful Girl. Creampie Baths.

  • ena satsuki censoredcreampiesingle workIENFienergykikurinieneIENF-183IENF1831ienf00183
    • 2021-12-31
    61 min

    [stcv-044]みすず(18)

  • amateur censoredcreampiebig titsstcvstcv-044stcv044stcv-044



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi