cowgirl javcensored high vision censored beautiful girl




FC2CAWDDASDGMEMABWNACXMARACHRVKBINGODJUFESPRDATIDMIDVSANSSNIMILKADNVEMAVENXHDKA

2021-01-24
131 min

[DMDG-050]Masochist Tits Creampie Hana Himesaki

  • himesaki hana censoredcreampiebig titsDMDGgain corporationDMDG-050DMDG050dmdg00050
    • 2021-01-30
    54 min

    [HHKL-082]Angel In White Vacuums Up Every Drop Of Her Patients Seed With Tight Pussy Cowgirl Nene Tanaka

  • nene tanaka censoredbig titsblowjobHHKLhuntervolvo nakanohhh groupHHKL-082HHKL082hhkl00082
    • 2021-01-30
    51 min

    C0930 ki210130 Yoshiko Yamauchi 30years old

  • amateur uncensoredc0930
    • 2021-02-05
    33 min

    [BTH-114]If You Do It On My Face, My Husband Will Find Out... At Least, Please Cum In My Mouth Instead Anri Sugisaki

  • anri sugisaki censoredmarried womanbukkakeBTHchobitchchovicBTH-114BTH114h-1435bth00114
    • 2021-02-17
    240 min

    [YVG-026]Perverted Slut Loves Licking Public Toilet Seats

  • censoredslutYVGgloryYVG-026YVG02613yvg00026
    • 2021-02-26
    42 min

    FC2PPV 1703238 [Personal shooting / Creampie] At the age of 40, sexual desire reaches its peak. The body in heaven mode overflows beyond shame.

  • amateur uncensoredfc2
    • 2021-02-28
    125 min

    [SGT-054]世田谷の妻たち 唐沢千賀子 SGT-054

  • chikako karasawa censoredcreampiebig titsSGTjewelSGT-054SGT054h-848sgt00054
    • 2021-03-01
    49 min

    FC2PPV 1706817 Remove the rubber without permission while inserting it into the slender JD. First round of vaginal cum shot without permission

  • amateur uncensoredfc2
    • 2021-03-08
    53 min

    FC2PPV 1717711 [Personal shooting] A 41-year-old mature wife who can not control her body that keeps aching without sex

  • amateur uncensoredfc2
    • 2021-03-13
    118 min

    [MUDR-142]I Committed A Sin A Beautiful Y********l In Uniform The Purge Of A Chastised Bitch Mahiro Ichiki

  • mahiro ichiki censoredcreampiebdsmMUDRmukuMUDR-142MUDR142mudr00142
    • 2021-03-16
    144 min

    [MXGS-1176]A Blatantly Cute Little Devil Of A Slut Narumi Hirose

  • narumi hirose censoredbeautiful girlsingle workMXGSmaxingMXGS-1176MXGS1176h-068mxgs01176
    • 2021-03-19
    181 min

    [DOCP-282]"Please Pump Me More With Your Cock!! Please!!" A Naughty And Haughty, Highly Conscious Girl Gets Slathered With Aphrodisiacs And Becomes Super Horny!! She's Shaking her Big Ass And Begging To Be Fucked! Pride-Shattering, Furiou

  • emily hikari sakuraba sawa lemo censoredcreampieDOCPprestigedoc premiumDOCP-282DOCP282118docp00282
    • 2021-03-29
    58 min

    [SHH-019]Seduced By A Massage Parlor Slut With My Wife Sitting Right Beside Me - She Climbed On Top Of My Cock And Rode It Slowly And Subtly Cowgirl Style Until I Gave Her A Creampie - Slender, Hot Booty Massage Parlor Domme

  • censoredslutSHHnatural highkansukeSHH-019SHH0191shh00019
    • 2021-03-31
    49 min

    FC2PPV 1739065 Hirosue ● Calling the legendary "Pukuman" Kanon, who looks like a child, on a holiday and taking a daytime affair Icha Koi Gonzo ❤️The finest oma * ko that holds the uncle’s uncle’s cheeks Many purchase benefits

  • amateur uncensoredfc2
    • 2021-04-20
    124 min

    [SDJS-113]The Manager's Daughter Was Besieged And Fucked This Middle-Aged Loser Was Fired From His Job At A Convenience Store, So He Decided To Get His Revenge And Fuck The Manager's Daughter Right Before His Eyes! Koharu Asai

  • asai censoredsingle workdramaSDJSsod createchinpo dazaisod female employeeSDJS-113SDJS1131sdjs00113
    • 2021-04-22
    178 min

    [MILK-108]She Wants To Fuck Immediately All Day Long, All She Thinks About Is Sex This Is How I Spent A Consecutively Ejaculating Date With A Big Tits Slut Akari Niimura

  • akari shinmura censoredbig titsslutMILKmilkMILK-108MILK108h-1240milk00108
    • 2021-04-24
    161 min

    [TNOZ-004]Titty From Colossal 40" Knockers - Cosplayer, Age 19, Big Tits (5-Some Orgy, 11 Loads) Nipple Orgasms And Deep Throat Face Fucking, Creampie Sex, Screaming Orgasms, Breaking In A Slut Endlessly...

  • censoredbig titscosplayTNOZall japan amateur photographers union daspit uncle 2 all japan kameko cooperatiTNOZ-004TNOZ004tnoz00004
    • 2021-05-01
    233 min

    [ZMAR-041]Complete! Chisato Shoda 2

  • shota chisato censoredbig titsmature womanZMARplanet plusthe whole damn thingZMAR-041ZMAR041h-237zmar00041
    • 2021-05-07
    120 min

    [FSDSS-221]She Cums Instantly, As She Always Plays With Her Clit To Keep Herself On The Edge Of Climax - Masho Arisaka

  • arisaka mayoi censoredbig titsbeautiful girlFSDSSfalenoyamaguchi memberfaleno starFSDSS-221FSDSS2211fsdss00221
    • 2021-05-08
    150 min

    [CHRV-132]This Innocent And Maso Huge Tits Lolita Was Awakened To The Pleasures Of Sex When She First Rode Her Unicycle My Little Stepsister's 99cm H-Cup Colossal Tits Are Worth More Than Just One Look Rimippe For 10 Years, I've Been Addicted

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-132CHRV132chrv00132
    • 2021-05-09
    79 min

    200GANA-2481 Seriously Nampa, first shot. 1634 Discovered when walking around Shinjuku under the name of "beaten shop"! A transcendental beautiful leg girl who accumulates work stress! "The best way to relieve stress is SEX! ], And it com

  • amateur censoredbig titsamateurganagana-2481gana2481200gana-2481
    • 2021-05-10
    120 min

    [TENX-21051]Faded Beauty Average Age Of Actresses = 54.7 Years Old

  • censoredmarried womanamateurTENXtennin xTENX-21051TENX21051h-1542tenx21051
    • 2021-05-14
    120 min

    [MVSD-465]Cock Licking Blowjob Loving Slut Will Run To Suck Cock As Soon As You Call! Arisu Nanase

  • alice nanase censoredschoolgirlblowjobMVSDm s video groupMVSD-465MVSD465mvsd00465
    • 2021-05-15
    105 min

    [DDHH-028]Confinement: Incontinence Classroom - Asuka Momose

  • momose asuka censoredschoolgirlblowjobDDHHdogmahidekiDDHH-028DDHH028ddhh00028
    • 2021-05-20
    57 min

    FCP-018 [Delivery only] New "Cho, wait, eh! In a place like this !？" 1 beautiful 3 people

  • amateur censoredamateurbeautiful girlfcpfcp-018fcp018fcp-018
    • 2021-05-27
    106 min

    [SPRD-1415]I Prefer My Older Ex To My New Younger Wife... Rie Takeuchi

  • rie takeuchi censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1415SPRD141518sprd01415
    • 2021-05-28
    198 min

    [WAAA-061]If You Can Withstand Honoka Mihara's Incredible Techniques You Can Fuck Her Raw!

  • mihara honoka censoredcreampiebig titsWAAAwanz factorywanzWAAA-061WAAA061waaa00061
    • 2021-06-05
    50 min

    H0930 ki210605 Shizuka Nojima 43years old

  • amateur uncensoredh0930
    • 2021-06-05
    140 min

    [PKPD-148]Amateur Fuck Buddy Documentary - Kinda Sorta Almost My Girlfriend - Record Of A Creampie Fuck With My Fuck Buddy Riku, An Office Lady With Colossal I-Cup Tits - Riku Serina

  • serina riku censoredcreampiebig titsPKPDfuck group and fun friends daydreamersPKPD-148PKPD148pkpd00148
    • 2021-06-11
    119 min

    [EBOD-832]Experienced Stepsister Breaks In Her Virgin Older Stepbrother! First She Flirts With Flashes Of Cleavage -> The Temptation Is Too Much And His Rock Hard Cock Is Ready To Ride Her All The Way To A Creampie! Ami Yozora

  • ami yozora censoredcreampiebig titsEBODe bodytrendy yamaguchiEBOD-832EBOD832ebod00832
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-07-09
    176 min

    [IPX-681]Gachimaji Major Top Secret AV Debut of a Real Idol. Mano Yoda.

  • mano yoda censoredbeautiful girlsingle workIPXidea pocketusa pyondishIPX-681IPX681ipx00681
    • 2021-07-14
    120 min

    [RKI-614]Ultra-Sexy Dirty Talk Master Lily Heart's Blowjob And Creampie Sex!

  • lily heart censoredcreampieblowjobRKIrookienao masakiRKI-614RKI614rki00614
    • 2021-07-20
    25 min

    FC2PPV 1931459 [No] God Style ☆ G Cup !! Shinjuku Le 〇 〇 Shop Clerk Cum Shot In Rich Life (Part 2)

  • amateur uncensoredfc2
    • 2021-08-02
    125 min

    [AARM-004]A Naughty Masturbation On All Fours Where You Get A Perfect View Of Her Ass And Her Playing With Her Clit And Pussy

  • ai kawana ayaka muto censoredanalAARMaroma kikakusatoshimaniaaromaAARM-004AARM004aarm00004
    • 2021-08-06
    54 min

    328HMDN-389 [Individual / Abs] An Elite Female Doctor, 45 Years Old, Is Completely Obedient To A Low-Educated Cock. Outflow Video That Is Blamed As Much As You Like For The Body Trained By Young People And Convulsions

  • amateur censoredcreampiemarried womanhmdnhmdn-389hmdn389328hmdn-389
    • 2021-08-08
    14 min

    10musume 080821_01 I’Ll Make You Feel Good By My Mouth, So I Hope This Might Cheer You Up？ Yu Nagata

  • amateur uncensored10musume
    • 2021-08-20
    89 min

    FC2PPV 2049322 Prefectural ③ I Will Retire Because I Don’T Think There Are Any More Top Balls-Limited-

  • amateur uncensoredfc2
    • 2021-09-01
    123 min

    [NACR-459]Oil Mania Mai Satsuki

  • satsuki mei censoredcreampieblowjobNACRplanet plushimurokkushichi ku ryuuNACR-459NACR459h-237nacr00459
    • 2021-09-03
    119 min

    [SHKD-964]Unless This Married Woman Gets Fresh Sperm Injected Into Her Pussy Within 48 Hours, She"ll Die, So In Order To Keep On Living, She"s Decided To Let That Man, Whom She Hates With A Passion, Creampie Fuck Her. Hikari Ninomiya

  • hikari ninomiya censoredsingle workdramaSHKDattackersmaeda bungoushi yoru akuSHKD-964SHKD964shkd00964
    • 2021-09-09
    60 min

    515BTGL-018 Rin (24)

  • amateur censoredcreampieamateurbtglbtgl-018btgl018515btgl-018
    • 2021-09-17
    177 min

    [PRED-335]Ex Local Broadcast Announcer Gets More Worked Up Than Usual For Horny Older Guys. 3 Scenes Of Full-on Fucking. Sakura Yoda

  • sakura yoda censoredslutsingle workPREDpremiumkyouseielegancePRED-335PRED335pred00335
    • 2021-09-27
    76 min

    259LUXU-1483 Luxury TV 1462 A Beauty Registered Dietitian Who Says He Lost Love Because Of His Affair Appeared. She Looks Nervous About Having Sex With The Man She Met For The First Time, But Her Body Reacts Sensitively As She Begins To Ripen As An A

  • amateur censoredamateurluxuluxu-1483luxu1483259luxu-1483
    • 2021-10-10
    87 min

    345SIMM-669 [Uncle All Drink J ○] A Serious Student Council President At School! Nacchan, A Nympho School Girl Who Cums Herself For Semen When She’S Alone With Her Uncle W I Met Nacchan Who Is Busy Preparing For The School Festival After A Long

  • amateur censoredcreampiesquirtingsimmsimm-669simm669345simm-669
    • 2021-11-12
    122 min

    [PRED-351]Someone, Please Calm My Throbbing Pussy ... I"m Never Satisfied, No Matter Who I Fuck, So Today, Just Like Every Day, I"m Out To Get Creampie Sex With A Man I Just Met, Just For The Pleasure Of It. Aika Yamagishi

  • aika yamagishi censoredcreampieblowjobPREDpremiumdaifuku kunelegancePRED-351PRED351pred00351
    • 2021-11-13
    117 min

    [KAGP-203]"I Never Thought An Old Lady Like Me Would Get Her Underwear Stolen ..." 5 This Married Woman Started Feeling Horny Just From The Thought Of Being Recognized Again As A Woman, And That Makes Her An Easy Lay

  • censoredcreampieblowjobKAGPkaguya hime pt mousozokutsumatori no okinakaguya hime ptKAGP-203KAGP203kagp00203
    • 2021-11-30
    132 min

    550ENE-002 [She’s All Body Fluids] Niagara Squirting & Enema Juice Mass Injection! Spocos Tile-Breaking Blow To De S Sister Completely Fallen Power Sex "Ass Hole Hirogachauu! ] Pursuit Anal Fuck! !! !! Tokyo Kancho 02 Ayaka-Chan (Ayaka Mo

  • amateur censoredanalbig titseneene-002ene002550ene-002
    • 2021-12-04
    138 min

    [XVSR-623]A Reincarnated Cinderella Girl A Splashy Debut Mizuki Sakino

  • mizuki sakino censoredsquirtingsingle workXVSRmax asono kancalenXVSR-623XVSR623xvsr00623
    • 2021-12-25
    151 min

    [KATU-092]Sally Mom With Big Nipples, Tall Anaconda Lover With Big Tits

  • censoredbig titsslutKATUkatsuo bussan mousouzokumaglowKATU-092KATU092katu00092
    • 2021-12-31
    118 min

    [NNPJ-490]I Want To Fuck A Girl From Minato Ward I Went To A Stylishly Moody Bar And Had Some Cool Evening Champagne To Start Things Off Right, And Then i Took This Slender Beauty Who Looked Good Enough To Be A Model To A High-Class Hotel For Some Co

  • censoredcreampiebeautiful girlNNPJnanpa japanNNPJ-490NNPJ490nnpj00490
    • 2022-01-01
    138 min

    [SOAN-069]MILF With Two K*ds Of Her Own Is Getting Both Of Her Holes Filled Again Today. Real Amateur Housewife That Thinks Her Husband Likes To Cheat Wants To Make Her Porn Debut Willingly. Sanae Sekikawa (Alias). Agrees To Cheating Anal Sex, Chapte

  • censoredamateurSOANyama to soramaketaro tanizokoanal visitSOAN-069SOAN069soan00069
    • 2022-01-07
    120 min

    [SSIS-293]A Former Celebrity After Abstention, It"s Time For Wild Sex With You She Was Teased To The Upper Limit Of Her Endurance, And After Being Pumped Full Of Aphrodisiacs, She Started Leaking Pussy Juices Everywhere As She Came Like A Wild Bi

  • nanatsumori riri censoredsquirtingSSISs one number one styleinabars1 no 1 styleSSIS-293SSIS293ssis00293
    • 2022-01-14
    153 min

    [MIAA-562]If You Have Money, You Can Do It! Girls With Big Tits Buying Large Amounts Of Creampie. Kokona Asakura. Kasumi Tsukino.

  • kasumi tsukino asakura here censoredcreampiebig titsMIAAmoodyzryo gokuminna no kikatanMIAA-562MIAA562miaa00562
    • 2022-02-04
    229 min

    [HUNTB-206]"Did A Little Shoot Out？ Did It Go In？" Aggressively Horny And Youthful Cherry Boy Cums Way Too Quick, So He Fucks Hard After Cumming To Keep His Friend From Finding Out! It"s Impossible To Keep It Secret Though...

  • censoredschoolgirlHUNTBhuntervolvo nakanohhh groupHUNTB-206HUNTB206huntb00206
    • 2022-02-11
    121 min

    [PPPE-012]6 Years Ago My Tits Were Taken Advantage Of By A Crazed Man, Now He"s Out Of Jail And He"s Coming To Put It Between My Colossal Tits. Titty Fuck Cum Loads, Pursued To Get Taken Advantage Of. Yuria Yoshine

  • yoshine yuria censoredcreampiebig titsPPPEoppaiPPPE-012PPPE012pppe00012
    • 2022-02-11
    119 min

    [EBOD-883]Busty Bike-Riding Tomboy College Girl With Heavy G-Cup Tits Makes Her Brand New Porn Debut Ichika Nanjo

  • nanjo ichika censoredbig titsbeautiful girlEBODe bodytrendy yamaguchiEBOD-883EBOD883ebod00883



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi