creampie beautiful girl censored def youthful




FC2IPXRBDWANZATIDHODVSANCJODMIAAPREDONEZSSNIAUKGSPRDSTARSFSDSSSHKDMVSDSSISAVSANATR

2021-01-09
120 min

[DASD-791]Hot Teacher Will Sweetly Show You Anything You Ask For. Yu Shinoda

  • shinoda yu censoredslutsingle workDASDdasrokusaburo mishimaDASD-791DASD791dasd00791
    • 2021-01-10
    48 min

    10musume 011021_01 Girl who can only be seen seriously was actually a nasty pervert FUJIKANA

  • amateur uncensored10musume
    • 2021-01-15
    150 min

    [SCOP-703]Finally Found It! This Little Brothel Is Out In The Middle Of Nowhere, Peacefully Making Modest Bank, But Unlike Most Brothels These Days You Can Creampie The Girls There! Don't Miss This Rare Experience - They'll Drain Your Balls D

  • censoredcreampiebig titsSCOPscoopjohnny shibuyamousouzokuSCOP-703SCOP703h-565scop00703
    • 2021-01-17
    105 min

    300MIUM-672 [I want to put raw chin in this ass! First place] Is it legally okay？ ？？ Rent a worried Lori beautiful girl as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! !! After enjoyi

  • amateur censoredcreampieamateurmiummium-672mium672300mium-672
    • 2021-01-19
    139 min

    [STARS-323]Mana Is A Beautiful Lady Boss Who Hates My Guts, And I Can't Abide By That, So I'm Going To Send Her To A Massage Parlor And Have Her Converted To Fit My Tastes! Mana Sakura

  • mana sakura censoredbig titssingle workSTARSsod createryo inugamisod starSTARS-323STARS3231stars00323
    • 2021-01-21
    156 min

    [SW-753]I Became a Teacher In Order To Have Sex With Cute Female S*****ts! 12

  • censoredbig titsSWswitchswitch switchSW-753SW7531sw00753
    • 2021-02-05
    115 min

    [PARATHD-3108](Emergency Broadcast) Hot Girls Are Pissing Themselves Live - Embarrassing Drenched Panties - Complete Edition

  • hebei haruna moe hazuki censoredPARATHDparadise tvPARATHD-3108PARATHD3108parathd03108
    • 2021-02-17
    130 min

    [GVH-197]Big Tits Servant - Yume Natsuki/Sakura Tsukishima

  • natsuki yume tsukishima sakura censoredslutdeepthroatGVHglorythin bladeGVH-197GVH19713gvh00197
    • 2021-03-05
    122 min

    [ONEZ-276](Complete POV) Loving Sex With My Super Cute Girlfriend At A Hotel Aoi Nakajo

  • nakagusuku censoredcreampieblowjobONEZprestigeonezONEZ-276ONEZ276118onez00276
    • 2021-03-16
    132 min

    [KUSE-008]After 30 Days Of Celibacy, She's Unleashing Her Lust! Demonic Piston-Pumping Action!! Furious Orgasms! She Loves Cock, And Now She's Surrounded In 360 Degrees Of Endless Perverted Muscle-Bound Sexual Release! Yota Chan

  • chanyota censoredsingle workKUSEsod createmid eyethis actress style is amazingKUSE-008KUSE0081kuse00008
    • 2021-03-23
    120 min

    [SHIC-203]I Was Lured To Temptation By My Wife's Stepdaughter ... Hikaru-chan

  • censoredbeautiful girlSHICadolscence.comSHIC-203SHIC203h-839shic00203
    • 2021-04-01
    120 min

    [NACR-407]My Mother-in-law Is A Reader Model Misuzu Kawana

  • misuzu kawana censoredcreampiesingle workNACRplanet plusbito sakurananakuruNACR-407NACR407h-237nacr00407
    • 2021-04-15
    88 min

    [HTHD-185]My Friend's Mother - The Last Chapter - Mako Oda

  • oda mako censoredcreampiemature womanHTHDcenter villagedaichi minamihona zonoHTHD-185HTHD185h-086hthd00185
    • 2021-04-17
    145 min

    [NNPJ-440]Picking Up Girls Who Love Korean Fashion In The City - Pink-Haired Babe With A Beautiful Smile Going To Beauty School Stars In Porn For Spare Cash To Fund Her K-Pop Hobby - Her Neck, Armpit, And Pussy Are All So Sensitive That She Beams Whe

  • censoredbig titsbeautiful girlNNPJnanpa japanNNPJ-440NNPJ440nnpj00440
    • 2021-04-18
    125 min

    [TKSH-020]Milky Masochistic Basketball Athlete - Miu Sugihara

  • miu sugihara censoredcreampiebig titsTKSHtoyohikochain demonyunkaiTKSH-020TKSH020tksh00020
    • 2021-04-29
    488 min

    [CVDX-445]Slurping, Sucking Female Vaginal Suction Power! You Get To Suck On A Mature Woman's Clit And Cum Until You Can Cum No More In This Creampie Sex Paradise 40 Ladies 8 Hours 2-Disc Set

  • censoredcreampiemature womanCVDXcenter villageCVDX-445CVDX445h-086cvdx00445
    • 2021-05-15
    144 min

    [LZDM-040]I Made A Big Mistake, And Now, To My Surprise, I Was Booked Into The Same Room As My Super Scary Boss During Our Business Trip I Was Trying To Hide My Bushy Bush But She Tweaked And Teased Me For 3 Days Straight With Lesbian Love

  • kasumi tsukino yano tsubasa censoredbig titslesbianLZDMlesreflagmanlezure dramaLZDM-040LZDM040lzdm00040
    • 2021-06-04
    90 min

    277DCV-183 Is it okay to send it home？ case.177 8 Life! A model figure that seems to have jumped out of a magazine! Moreover, big breasts! This is a super body! ⇒ Does a good-shaped dick get angry with a woman？ A rare cock mania that rolls up spear!

  • amateur censoredbig titssquirtingdcvdcv-183dcv183277dcv-183
    • 2021-06-04
    105 min

    [YMDS-034]Young Lady's Catering Service: Angelic Little Hono (H-Cup)'s Small Animal-Like Fluffy Soft Big Tits! With Hono Wakamiya

  • honoka wakamiya censoredcreampiebeautiful girlYMDSmomotaro video publishingasakusa is jiroyoung peachYMDS-034YMDS034ymds00034
    • 2021-06-05
    240 min

    [DSD-828]Glistening Slippery Oil Fuck!! 2

  • emma hick julie cash censoredbig titsDSDmomotaro video publishingmarchinsweetdevilDSD-828DSD828dsd00828
    • 2021-06-05
    61 min

    Caribbeancom 060521-001 Look At Me having SEX! and Jerk Off On My Face! 4 Saori Miyazawa

  • saori miyazawa uncensoredcreampiebukkakecaribbeancom
    • 2021-06-12
    51 min

    C0930 ki210612 Aiko Hashimoto 48years old

  • amateur uncensoredc0930
    • 2021-06-19
    120 min

    [JUL-623]The Big Dick At Work Made Me Lose My Mind ~ Deeply Branded With The Pleasure Of Despair ~ Maki Tomoda

  • maki tomoda censoredmature womansingle workJULmadonnakitorune kawaguchiJUL-623JUL623jul00623
    • 2021-06-28
    61 min

    328HMDN-377 [9 Head Body] Insta Newlyweds Akagachi Model Mom Cuckold 25 Years Old And Seed With A Large Sperm! I caught it with a model of Mama’s swimsuit and doubled the sensitivity with calling oil. Acme who is completely fallen by being fucke

  • amateur censoredcreampiemarried womanhmdnhmdn-377hmdn377328hmdn-377
    • 2021-07-02
    125 min

    [JUL-639]I Sexually Teased My Voluptuous Lady Boss (Who Is Very Strict With Her Employees) But Instead Of Getting Mad, In The End, She Let Me Fuck Her. Yumi Kazama

  • kazama yumi censoredbig titsmature womanJULmadonnabieber gonzoJUL-639JUL639jul00639
    • 2021-07-02
    124 min

    [ADN-329]A Married Woman Who Is Unfaithful On Her Wedding Anniversary. Iroha Natsume

  • natsume saiharu censoredsingle workdramaADNattackersdragon nishikawaotona no dramaADN-329ADN329adn00329
    • 2021-07-02
    47 min

    230OREC-807 Ayumi

  • amateur censoredcreampiesquirtingorecorec-807orec807230orec-807
    • 2021-07-14
    118 min

    [SSIS-126]She Won't Say No: An Idol Clad In A Sexy Costume Spends A Steamy Night In A Hotel Room With The Sexual Harasser Boss She Hates So Much - Aqua Yamazaki

  • mizuyama yamazaki censoredbig titsbeautiful girlSSISs1 no 1 stylerokusaburo mishimaSSIS-126SSIS126ssis00126
    • 2021-07-20
    137 min

    [SDTH-010]Sex Is Always Better In The Raw! I Love To Fuck In The Raw! A Curious And Precocious Teenage Gal With An Immature Pussy Koenji ** Shopping District, Suginami City, Tokyo She's A S*****t At A Part-Time School, In Her 3rd Year, Class C Ur

  • hazuki urara censoredcreampieschoolgirlSDTHsod createafro takahashieromanceSDTH-010SDTH0101sdth00010
    • 2021-07-27
    64 min

    Caribbeancom 072721-001 Prohibit masturbation and increase sensitivity! Massive squirting! Three consecutive vaginal cum shots! Runa Hinata

  • runa hinata uncensoredcreampiehandjobcaribbeancom
    • 2021-08-01
    120 min

    [NACR-445]My C***dhood Friend Is My Submissive Pet Haruki Ashina

  • haruki ashina censoredblowjobsingle workNACRplanet plussakura ninshichi ku ryuuNACR-445NACR445h-237nacr00445
    • 2021-08-18
    127 min

    [OVG-179]My Younger Stepsister Lets Me Fuck Her

  • mei kosaka momose asuka censoredcreampieschoolgirlOVGglory questOVG-179OVG17913ovg00179
    • 2021-08-30
    80 min

    259LUXU-1470 Luxury TV 1450 A Beautiful Blogger Who Fascinates Men In The World With A Beautiful Style Like A Model Appears In An Emergency AV! Don’t Miss The Wild Standing Back That Leaves You To The Uncontrollable Libido And Tastes A Man Indec

  • amateur censoredamateurluxuluxu-1470luxu1470259luxu-1470
    • 2021-09-04
    125 min

    [BAHP-086]Love Hotel Sex Between A Girl With A Big Ass And Tits, And Her Perverted Boyfriend Starring Kanon Ibuki

  • kanobuki censoredcreampieblowjobBAHPbarutanyoshida daibutsuhoppinBAHP-086BAHP086bahp00086
    • 2021-09-10
    118 min

    [JUL-709]My Beloved Stepmom Raised Me By Herself, And Now, She Was Being Fucked By My So-Called Friend ... Yu Shinoda

  • shinoda yu censoredcreampiemature womanJULmadonnashiro shotenJUL-709JUL709jul00709
    • 2021-09-14
    89 min

    261ARA-507 [Too Beautiful] [Too Cute] Arisa-Chan Is Here! !! The Reason For Applying For A Beautiful Girl Is "I Want Ji ● Po ♪ I Want To Lick W" I Have Been Frustrated For 2 Weeks! Yariman Remarks ♪ Ready For Upper Milk With Hami Butt! !! [Du

  • amateur censoredamateuraraara-507ara507261ara-507
    • 2021-09-17
    82 min

    FC2PPV 2212716 J-Cup-Chan And Kan * Re Kaohsiung ♪ In Bright Red Echii Underwear-Ecchi Edition- [Personal Shooting]

  • amateur uncensoredfc2
    • 2021-10-02
    240 min

    [YLWN-184]Bane Of Men With Hot Wives "My Wife Is A Woman Who Could Refuse When Asked... So An Affair？" 240 Minutes

  • censoredamateurYLWNyellow moon iero mu npatpong tateishiyellow moonYLWN-184YLWN184ylwn00184
    • 2021-10-05
    61 min

    Caribbeancom 100521-001 The Continent Full Of Hot Girls, File.084 Kurumi Kokoro

  • kurumi kokoro uncensoredcreampiecaribbeancom
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-05
    179 min

    [HODV-21621]Hobbies of Highly-Educated Massage Parlor Girl Rumored To Have IQ Over 130 Are Reading and Sex. Akane Shiki

  • akane shiki censoredsquirtingslutHODVh m pHODV-21621HODV216215642hodv21621
    • 2021-11-09
    59 min

    [110921-001]Complaint Office Lady Apologize with the Body Vol.8 Cowgirl Dogeza! I"m sorry I"m the only one cum!

  • chiaki saeki uncensoredcreampiehandjobcaribbeancom
    • 2021-12-03
    129 min

    [ADN-360]Used By Sexually Harassing Boss At My Part-Time Job Who I Hate For Sexual Gratification. Runa Tsukino

  • tsukino luna censoredcreampiebeautiful girlADNattackerssada oka sadaootona no dramaADN-360ADN360adn00360
    • 2021-12-04
    129 min

    [RPIN-058]This Doe-Eyed Big Ass Elder Sister Type Is A Beautiful Massage Parlor Therapist Who Loves To Sock Cock, And Now She"s Descending Into Hot, Buttery Pleasure Through An Erotic Massage And A Big Dick!

  • censoredamateurRPINrikopin mousozokuoozora kakeruRPIN-058RPIN058rpin00058
    • 2021-12-14
    55 min

    10musume 121421_01 I Feel Hot While I Was Taking Acting Lesson MINAMISAKI

  • amateur uncensored10musume
    • 2022-01-08
    78 min

    FC2PPV 2577989 A Real Virgin Teenage Active Student. She Is Too Cute And The Undeveloped Body Of A Small Animal Girl Is Too Erotic. The Small Inexperienced Pussy Has Outstanding Sensitivity And Is The First Mass Facial Cumshot In Her Life.

  • amateur uncensoredfc2
    • 2022-01-11
    103 min

    FC2PPV 2585116 Former Idol Appeared! !! !! , A Genuine Former Entertainer! !! , I’m From That Super Famous Idol Group, And I’m Really Cute. The 200th Original "Personal Shooting" Individual Shooting [cen]

  • amateur uncensoredfc2
    • 2022-01-29
    132 min

    [MOPP-048]A Naughty Maid Gave Me The Slut Treatment And Provided Me With Some Anal Pleasure, And Transformed Me Into Her Obedient Pet. I"m Cumming Like A Bitch! The Maso Man House Nonoka Sato

  • is it sato momoka kato censoredanalblowjobMOPPm o paradisemo platinumMOPP-048MOPP048mopp00048
    • 2022-02-18
    119 min

    [HMN-123]Cuckold In The Same Room With A Sexually Frustrated Female Friend - A Story Of A Girl Getting Some Aphrodisiacs From Her Horny Guy Friend And Then Having Creampie Sex Repeatedly - Juri Mitani

  • mitani akari censoredcreampiesingle workHMNhon nakabungo maedaHMN-123HMN123hmn00123
    • 2022-02-18
    38 min

    FC2PPV 2670186 Appearance! !! Limited Number! [Uncensored] I Want You To Be More Excited When You See Me … A Girl With Big Breasts Who Is Good At Begging For A Soft Sweetness. Creampie Twice In A Nasty Appearance That Only I Can Show! !! (Featur

  • amateur uncensoredfc2
    • 2022-02-24
    15 min

    [HEYZO-2728]Manami Ueno Manami"s Amazing Hand Job

  • manami ueno uncensoredhandjobheyzo
    • 2022-03-03
    62 min

    200GANA-2655 In The Spear Room Of The Nampa Master Of 100 Battles, Take Out Sex Hidden Shooting Take Out The Child You Met By A Friend’s Introduction On The Same Day! Play With Toys And Pave The Way For Sex With The Idiom Of A Punishment Game If

  • amateur censoredamateurganagana-2655gana2655200gana-2655
    • 2022-03-03
    115 min

    [MILK-137]Super Slim Innocent Beauty Wants To Suck And Gets Tied Up And Educated How To Suck His Cock Hard. Sumire Kuramoto.

  • sumire kuramoto censoredcreampiebeautiful girlMILKmilkMILK-137MILK137h-1240milk00137
    • 2022-03-04
    150 min

    [IPX-838]A Hot Spring Resort Vacation Documentary, Filled With Nothing But Fucking With Minami Aizawa! POV! No Makeup! Party Time! Eroticism-Baring POV Sex!

  • minami aizawa censoredsingle workIPXidea pocketdishIPX-838IPX838ipx00838
    • 2022-03-12
    40 min

    FC2PPV 2714927 * Limited Quantity * 4000pt → 1700pt [Appearance] [Nothing] [Normal Hd High-Definition Version] A Neat And Clean Active Reading Mogal With A Very Thin Style! It's A Fiercely Rich Raw Vaginal Cum Shot!

  • amateur uncensoredfc2
    • 2022-04-02
    118 min

    MGMP-060 Masochistic Fetish For Rubber Gloves Slutty Dental Hygeneist Pervertedly Squeezes Semen Out Of Gloves Clinic

  • amu ohara arimura nozomi censoredslutMGMPmegamibeautiful goddess premiumMGMP-060MGMP060mgmp00060



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi