def amateur kiss censored javcensored




FC2MIAABLKMEYDMVSDHUNTBVENUSSISHNDDTTSPRDHDKAAUKGGMEMDASDFSDSSMIDVSHKDSTARSAWDONEZ

2020-09-26
43 min

FC2PPV 1515011 [Limited quantity 2980pt → 1980pt] Former surfer’s cabaret who was deceived by massage recruitment ❤️ I got a little horny after sunburn and went to a selfish body with a thick oil massage ❤️ There is a purchase privilege

  • amateur uncensoredfc2
    • 2020-09-27
    104 min

    [VENU-966]This Stepmother And Stepson Start Fucking 2 Seconds After Stepdaddy Leaves The House Sachiko

  • sachiko censoredcreampiebig titsVENUvenuspeterfakecest winntersVENU-966VENU966venu00966
    • 2020-10-01
    30 min

    416SVMM-036 Ainasan

  • amateur censoredbig titsamateursvmmsvmm-036svmm036svmm-036
    • 2020-10-02
    51 min

    FC2PPV 1516255 [Limited quantity 2980pt → 1980pt] Staying hot spring with a beautiful girl ❤️ Icha LOVE mixed bathing blowjob ❤️ Move to bed and lick a lot of pink nipples ❤️ Cum shot in various positions and angles There is a purchase privilege

  • amateur uncensoredfc2
    • 2020-10-10
    428 min

    [KRU-097]Filmed By The Manager Of A Famous Supermarket In The City This Beautiful Married Woman Shoplifter Is Getting Pounded With Creampie Sex With The 20cm Dick Of A Corrupt And Horny Store Manager

  • censoredcreampiebig titsKRUkarmamanji groupKRU-097KRU097kru00097
    • 2020-10-24
    145 min

    [CAWD-132]A Rapid Debut For A Real Young Talent Who Chose To Appear In AV Rather Than In Major Entertainment Productions - Himeka Minato

  • himeka minato censoredbeautiful girlsingle workCAWDkawaiitake dCAWD-132CAWD132cawd00132
    • 2020-11-06
    71 min

    [hoi-142]リサリサ(19)

  • amateur censoredbig titsamateurhoihoi-142hoi142hoi-142
    • 2020-11-06
    161 min

    [ABW-022]Gorgeous Girl's Amazing Escort Sex - She Seduces A Younger Amateur Guy Body And Soul With Wild Sex Airi Suzumura

  • suzumura airi censoreddeepthroatsingle workABWprestigepunonpen ryouabsolutely wonderfulABW-022ABW022118abw00022
    • 2020-11-13
    67 min

    259LUXU-1333 Luxury TV 1326 Its appearance is just a goddess! Nozomi Makita, a hotel front lady who is too beautiful, is back! It seems that frustration has been refined for the first time in the previous work to have sex. A sexually hungry beauty de

  • amateur censoredamateurluxuluxu-1333luxu1333259luxu-1333
    • 2020-11-13
    145 min

    [IPX-561]She Can't Live Without Sex Any Longer... 153 Intense Orgasms, 1962 Vaginal Spasms, 3104 Hard Thrusts, Ecstasy Like You've Never Seen Before Kanon Yano

  • kanon yano censoredbig titssquirtingIPXidea pocketdishIPX-561IPX561ipx00561
    • 2020-11-23
    132 min

    [ANZD-045]Neck, Back, Armpits - College Girl Licked All Over Her Body Until She Cums So Hard She Wets Herself Hina

  • censoredamateurANZDapricot mousouapricotANZD-045ANZD045anzd00045
    • 2020-12-07
    64 min

    345SIMM-568 [G milk gal married woman and home affair] At home where former Kano who became a married woman and her husband are absent …

  • amateur censoredcreampiebig titssimmsimm-568simm568345simm-568
    • 2020-12-11
    25 min

    FC2PPV 1602635 [No] Master. I’ll be off for a day today and I’ll enjoy “off paco” ♥ -Toys- [Personal shooting]

  • amateur uncensoredfc2
    • 2020-12-28
    56 min

    328HMDN-324 [Personal shooting] Boyish JD, a 20-year-old swimmer, is blamed for a muscle slender body and has abdominal muscle cracks while continuously alive.

  • amateur censoredcreampieamateurhmdnhmdn-324hmdn324328hmdn-324
    • 2021-01-08
    55 min

    FC2PPV 1635445 Hina 19 years old Innocent beautiful girl who wants to be an idol! Super talent with 100 transparency! Pure white beautiful breasts x nice ass are horny with raw cock! Creampie with seeds on a super sensitive body with outstanding sens

  • amateur uncensoredfc2
    • 2021-01-29
    62 min

    FC2PPV 1660188 500pt OFF until 2/7 (Sun) !! [No / Piece] What is important is money !？ Or love !？ Aya who wants to support her who came to H with her boyfriend yesterday, unlicensed vaginal cum shot with a secret Gonzo to her boyfriend !! * There is

  • amateur uncensoredfc2
    • 2021-02-05
    114 min

    [ONEZ-275]My C***dhood Friend Is A Sexual Monster I Was Fucking My C***dhood Friend Every Day, But Now We're Spending More Than 2 Weeks Abstaining From Sex. When We Got Back To Fucking After A Long Layoff, We Hungered For Each Other Like Ravenous

  • yui satonaka censoredcreampieuniformONEZprestigetodoonezONEZ-275ONEZ275118onez00275
    • 2021-02-11
    138 min

    [IESP-676]Suzu Monami: Lesbian Unleashed - I Fell In Love With My Step-sister

  • monami bell toua kotone censoredlesbiandramaIESPienergykikuriniespIESP-676IESP6761iesp00676
    • 2021-02-11
    124 min

    [NSM-028]An Aphrodisiac Oil Massage Peeping & Creampie Fucking With Amateur Girls VOL.28 We Used This Compound Of Super Powerful Aphrodisiacs Mixed Into Massage Oil And Used It On These Unsuspecting Ladies, And They Were Surprised To Find Their Bo

  • gloss hall shiori endo bookmark satoshi yamaguchi censoredcreampieNSMnishi shinjuku massage main officeaphrodisiac massageNSM-028NSM028h-1342nsm00028
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-25
    266 min

    [PIYO-105]A J* Goes Walking In This Special Edition - You're Going On A Lover's Date With 3 Outstanding, Kind And Gentle, Adorable Beautiful Girl Babes And Having All The Sex You Can Possibly Handle! -

  • censoredbeautiful girlPIYOchickclown fieldPIYO-105PIYO1051piyo00105
    • 2021-03-12
    146 min

    [SCOP-711]Checking Out A Lead That Says There Are Super Sensitive Slutty Masseuses Rub Oil On Their Bodies While Their Customers Watch And Shake Their Asses!

  • censoredcreampiebig titsSCOPscoopk taromousouzokuSCOP-711SCOP711h-565scop00711
    • 2021-03-13
    148 min

    [MIAA-407]I Devoted My Heart And Soul To Raising My Young Stepdaughter, And Now She's Hooked On Her Big Dick Boyfriend! Plus, Premature Ejaculating Orgasmic And Spasmic Creampie NTR Hana Shirato

  • white peach censoreduniformbeautiful girlMIAAmoodyzusa pyoneveryone s porn starMIAA-407MIAA407miaa00407
    • 2021-03-18
    235 min

    [HUNTA-975]"Hey Big Stepbrother ... Why Did You Do Such A Thing (Kiss Me) Yesterday？" My Little Stepsister Was Just My Type, So When I Unexpectedly Found Myself Kissing Her ... I Have A Super Cute Little Stepsister. And I Know That We're

  • censoredcreampieschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-975HUNTA975hunta00975
    • 2021-03-26
    56 min

    FC2PPV 1741765 [Over 4 hours in total] 2020 First shot deleted due to various circumstances 〇-chan 4 works Comp pack Resale never again [Personal shooting]

  • amateur uncensoredfc2
    • 2021-04-02
    98 min

    [SHKD-940]Don't Touch My Step Sister, She's Mine! Rin Kira Aoi Kururugi

  • kira rin aoi kururugi censoreduniformsisterSHKDattackerskazuki kuryusharkSHKD-940SHKD940shkd00940
    • 2021-04-06
    184 min

    [SDNM-274]Beautiful Caretaker Happily Serves Old Men Every Day Miyu Kurita 28 Years Old Porn Debut

  • miyu kurita censoredsingle workSDNMsod createcompany matsuogenuine married woman the porn experienSDNM-274SDNM2741sdnm00274
    • 2021-04-17
    119 min

    [HND-973]Everybody Here Thinks I'm A Virgin... Shy New Drummer In A Light Rock Band Shows Off The Raging Lust She's Been Hiding In Her Creampie Porn Debut Saya Fujikawa

  • saya fujikawa censoredcreampieuniformHNDhon nakatiger kosakaiHND-973HND973hnd00973
    • 2021-04-18
    240 min

    [BRTM-024]Infinite Cumming: Tied Up And Fully Restrained Female Bodies

  • censoredBRTMkm produceblack realBRTM-024BRTM024brtm00024
    • 2021-05-01
    150 min

    [SSIS-061]Pleasure! Sexy Model Fucks 3 Times Kaoru Yasui

  • kaoru yasui censoredbig titssquirtingSSISs1 no 1 stylemon cSSIS-061SSIS061ssis00061
    • 2021-06-22
    73 min

    300MAAN-667 [Baby Face x Big Breasts / Brain Iki x Vagina Iki / Massive Squirting & Cum Shrimp Warp] H Cup De M Daughter Brought Up By Nature! Izakaya clerk / no hand masturbation who came to have sex from Yamanashi for 3 hours one way! ？？ Toro sq

  • amateur censoredbig titssquirtingmaanmaan-667maan667300maan-667
    • 2021-06-24
    127 min

    [SW-783]"I Might Be Dumb But When It Comes To Sex I'm At The Top Of The Class! If You Do My Homework I'll Make You Feel Real Good, So Please!" Can You Believe She Said That To Me!？ Since Then She Lets Me Let Off Steam Every Day No Mat

  • censoredSWswitchlight fujimaswitch switchSW-783SW7831sw00783
    • 2021-06-27
    239 min

    [RDVHJ-134]Picking Up Amateur Housewives! Gallons Of Squirting! Gallons Of Creampie Jizz! 12 Loads! 4 Hours!

  • censoredbig titsmarried womanRDVHJgraffiti japanfair estRDVHJ-134RDVHJ13448rdvhj00134
    • 2021-07-10
    108 min

    [QRDA-130]Sadist Female S*****t Council Group Leg Tease

  • erica censoredanalQRDAqueen roadQRDA-130QRDA130qrda00130
    • 2021-07-17
    153 min

    [CAWD-249]Modest And Quiet, But I Love Sex ... Natsu Hinata's Extreme Coming x 2! 3 Penetrations

  • natsu hinata censoredsquirtingbeautiful girlCAWDkawaiimichiru arashiyamCAWD-249CAWD249cawd00249
    • 2021-07-18
    239 min

    [OKAX-751]The Girl Next Door Is Actually An Aggressive Sex Fiend!! 4 Hours Of 20 Lustful Girls!

  • censoredbig titsblowjobOKAXk m produceokazuOKAX-751OKAX751okax00751
    • 2021-07-22
    120 min

    [MIAA-477]Female Detective Sneaks In As A Decoy! Aphrodisiac Oil Bondag With Endless Orgasms Version Sakura Tsuji

  • sakura tsuji censoredcreampiebig titsMIAAmoodyztrendy yamaguchieveryone s porn starMIAA-477MIAA477miaa00477
    • 2021-07-22
    118 min

    [MIAA-476]Since The Troublesome Girl From Nextdoor Staying At My Home Is Resting Defenselessly, I'll Use Her As An Onahole And Impregnate Her Siren Silently

  • horikita wan censoredcreampieuniformMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-476MIAA476miaa00476
    • 2021-08-07
    121 min

    [XRL-021]Beautiful Bondage Babe Wants To Get Spanked - And Deep Throat Your Dick! 4

  • peach scent chisato mori censoreddeepthroatXRLk m producereal real worksXRL-021XRL021xrl00021
    • 2021-08-10
    44 min

    FC2PPV 1980808 [Individual Shooting] Prefectural General Course ③ A Girl Who Is Forced To Have Sexual Intercourse With A Stranger By A Classmate And Is Groped By An Uncle And Drips White Love Juice.

  • amateur uncensoredfc2
    • 2021-08-14
    120 min

    [KSBJ-152]My Husband"s Brother and My Secret Fertility Treatment: Asuka Rinna

  • asuka riina censoredcreampiebig titsKSBJksb kikaku emmanuellesakura ninKSBJ-152KSBJ152ksbj00152
    • 2021-08-22
    98 min

    300NTK-626 [Indecent G Breast Nippon Representative Class Boyne Beauty JD & Slender International Student And Throat 4p Special! !! ] Powerful Big Pie That Jumps Out Of Cosplay! !! Reason Collapses On A Sizzle-Filled Nipple! !! Big Explosion! !! W

  • amateur censoredcreampiebig titsntkntk-626ntk626300ntk-626
    • 2021-08-27
    128 min

    [WZEN-048]Banned 01, Pharmaceutical Company Office Worker Mika (27)

  • censoredcreampiedeepthroatWZENwaap entertainmentWZEN-048WZEN0482wzen00048
    • 2021-09-09
    110 min

    [GS-403]When I Scribbled That I Was Looking For A Sex Friend In A Public Toilet, A Girl Who Loves Sucking On Cocks And Giving Blowjobs Came!! She Contacted Me, So I Waited In The Toilet. Then, This Girl Came In Without Any Panties And Her Pubic Hair

  • censoredschoolgirlGSsosoru x garconred ballGS-403GS403h-101gs00403
    • 2021-09-14
    32 min

    C0930 ki210914 Eriko Ikegami 24years old

  • amateur uncensoredc0930
    • 2021-09-24
    150 min

    [ROYD-068]My dick got rock hard after seeing the breasts of a C***dhood friend who grew up sexier than I expected! Her parents and mine aren"t home, so she came to stay a night at my place. Yuria Hakaze

  • yuria hafu censoredschoolgirlsingle workROYDroyalkawajirihhh groupROYD-068ROYD068royd00068
    • 2021-09-30
    141 min

    [AARM-019]This Ex Gal Has Gotten 100 Guys Off In Her Past, Now She Brings Her Amazing Temptress Techniques To Give Full Satisfaction At Home By Opening A Sexy Masochistic Salon. Wakana Asamiya

  • wakana asamiya censoredhandjobsingle workAARMaroma kikakukadowaki shigeoaromaAARM-019AARM019aarm00019
    • 2021-10-02
    101 min

    [SQTE-384]Creampie Sex With H-cup Otaku Madoka - Madoka Shizuki

  • madoka shizuki censoredcreampiebig titsSQTEs cutes cute s cuteSQTE-384SQTE384sqte00384
    • 2021-10-05
    64 min

    SIRO-4647 [First Shot] [Good Service] [Enchanted Curvaceous Beauty] Discover A Sensitive Husky Voice Beauty With Excessive Love Juice Secretion. In Contrast To Her Slightly Flashy Looks, She Gets Drunk With Pleasure While Dyeing Her Cheeks Red, And S

  • amateur censoredamateursirosiro-4647siro4647siro-4647
    • 2021-10-12
    480 min

    [KTRA-339]A Beautiful Girl Wearing Glasses: 10 Girls, Continuous Sex, 38 Hours, A Set of 2 DVDs

  • airi sato swan ti censoredbeautiful girlKTRAk tribeKTRA-339KTRA339h-094ktra00339
    • 2021-10-14
    63 min

    299EWDX-382 Sura Milk H Cup! Convulsions Acme Barrage With Raw Ji ○ Port After A Long Absence!

  • amateur censoredcreampiebig titsewdxewdx-382ewdx382299ewdx-382
    • 2021-10-30
    124 min

    [GVH-313]The Beautiful Teacher Who Fell Into the Den of Delinquent S*****ts. Mai Kagari

  • flower hunting censoredcreampiesingle workGVHglory questkimura hajimeGVH-313GVH313gvh00313
    • 2021-11-11
    55 min

    413INST-182 [Married Woman 5P Orgy Individual Shooting 3] Oil Puru Puru W Big Breasts I Cup Two Married Women Young Penis A Bikini Wife Who Goes Crazy For Deliciously

  • amateur censoredcreampiebig titsinstinst-182inst182413inst-182
    • 2021-11-25
    135 min

    [SDDE-658]【ALL自撮り動画】修学旅行中 東京で男を喰いまくったえっちな記録 新井リマ

  • arai rima censoredSDDEdazai chinpodazai chinposod createSDDE-658SDDE658
    • 2021-11-29
    86 min

    534IND-015 Unusual Libido Of Ordinary Office Lady! !! Confidential P Activity Is Safely Washed Away! !! Erotic Older Sister Is Extremely Lively! !!

  • amateur censoredcreampieamateurindind-015ind015534ind-015
    • 2021-12-21
    55 min

    230OREC-961 Moeka (Momoyama Moeka)

  • amateur censoredcreampiebig titsorecorec-961orec961230orec-961



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi