def creampie javcensored over hours squirting




FC2EBODMVSDHODVAUKGJUFEDASDNGODNATRVEMASPRDSTARSCHRVSHKDSQTEHZGDHNDAUKGMIDVVENUBLK

2021-01-19
57 min

107HISN-017 It looks like this and the number of experienced people exceeds 3 digits Former shot put player Ayaka Hirosaki (23) [Distribution exclusive] SOD rookie AV debut 165cm 61kg B: 92 (E) W: 78 H: 103 Ayaka Hirosaki

  • amateur censoredsquirtingamateurhisnhisn-017hisn017107hisn-017
    • 2021-01-22
    74 min

    [OTIM-052](For Streaming Editions) (Daydream POV Fantasies) Ovulation Day Babymaking Sex With A Maid Who Will Do Whatever I Say And Will Belong Only To Me Kanna Shiraishi

  • shiraishi plane censoredcreampieblowjobOTIMprestigeonetimeOTIM-052OTIM052118otim00052
    • 2021-01-23
    119 min

    [NNPJ-427](Usually I Would Never Fall For This Trick) She's Smiling Bravely, But She Was Dumped By Someone She Loved... And She Was So Lonely, She Allowed Herself To Be Seduced.

  • censoredcreampieblowjobNNPJnanpa japanNNPJ-427NNPJ427nnpj00427
    • 2021-01-30
    35 min

    FC2PPV 1665636 [4K shooting] I got in touch for the first time in 2 months and took a gonzo! A large amount of man juice overflowed from the super glossy pantyhose and the erotic mode was fully opened!

  • amateur uncensoredfc2
    • 2021-02-11
    40 min

    [ore-752]サリナ

  • amateur censoredcreampiebig titsoreore-752ore752ore-752
    • 2021-02-16
    130 min

    [SDAB-171]A Horny, Dirty, Middle-Aged Man Filmed Himself Having A Full-On Fuck Fest With An F-Cup Titty Light-Skinned Gal And Ejaculated Like Crazy During A Hot Spring Vacation Video 12 Ejaculations Kanon Shiraishi

  • kanon shiraishi censoredbig titsuniformSDABsod createrakudaone s youthSDAB-171SDAB1711sdab00171
    • 2021-03-03
    150 min

    [PFES-006]Married Secretary's Exposed Thighs Boss Humiliates Celibate Wife In The Office Marina Shiraishi

  • rena shiraishi censoredbig titsmature womanPFESmadonnajotaro tomisummer panties festivalPFES-006PFES006pfes00006
    • 2021-03-18
    59 min

    FC2PPV 1731019 [Treasure child] M sensitivity is good! Shuri-chan’s first shooting that is easy to live! The appearance that you really feel in a fierce blame is super chewy! I can’t stand being impatient … Insert it from myself and se

  • amateur uncensoredfc2
    • 2021-03-21
    176 min

    [HND-969]Masochistic Man Gets Tired Up And Branded Bondage-Loving Perverted Woman Makes Him Cum In Her Until She's Pregnant Rei Kuruki

  • satoshi kuruki censoredcreampiesquirtingHNDhon nakanao masakiHND-969HND969hnd00969
    • 2021-03-21
    240 min

    [CJOB-082]I'll Tease Your Nipples Until You Blow Your Load Endlessly Best 2

  • julia ichika matsumoto censoredcreampieslutCJOBslut havenslut haven bestCJOB-082CJOB082cjob00082
    • 2021-03-25
    233 min

    [NHDTB-507]Her Pussy Is Gushing So Much Her Panties Are Soaked - Obedient Girl With Big Tits Felt Up And Can't Resist How Much It Turns Her On

  • censoredbig titssquirtingNHDTBnatural highvanilla sakuraiNHDTB-507NHDTB5071nhdtb00507
    • 2021-03-25
    230 min

    [SUN-009]Cum Guzzling Perverted Nutritionist Sucks Dick With Her Long Tongue

  • moe kominato censoredbig titssingle workSUNsunSUN-009SUN00913sun00009
    • 2021-03-26
    86 min

    510ELLO-003 Pachislot / Karaoke / Private house side Home rental gal god video

  • amateur censoredamateurbeautiful girlelloello-003ello003510ello-003
    • 2021-04-12
    64 min

    328HMDN-353 [Genuine cheating video] G cup big breasts 37 years old! A real lewd wife who can’t stop cheating. She is a delightful acme when she is stabbed by her favorite men selected on Tinder with a raw dick. Fully seeded [Personal shooting]

  • amateur censoredcreampiebig titshmdnhmdn-353hmdn353328hmdn-353
    • 2021-04-16
    87 min

    HEYZO 2523 Trip To Hot Spring With FWB -Pervert Girl Loves Creampie- – Yukari

  • yukari uncensoredheyzo
    • 2021-04-23
    119 min

    [MIDE-918]I Was Seduced By My Female Supervisor Minami Who Showed Me Glimpses Of Her Panties While Smiling At Me... Minami Hatsugawa

  • hatsukawa minami censoredslutsingle workMIDEmoodyzzaku araimoodyz divaMIDE-918MIDE918mide00918
    • 2021-04-26
    90 min

    FC2PPV 1787200 [Individual shooting 37] Complete appearance 20 years old Legal Lori Paipan Serika ③ 2 Reinjection after continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-07
    119 min

    [MEYD-675]I Went To A Rubber Mat Health Club That Didn't Allow Fucking, And Out Came The Haughty And Naughty Beautiful Married Woman From Next Door. Now That I Knew Her Secret, I Could Get All The Sex And Creampie Fucking I Wanted! And Even Outsi

  • hikari hime censoredcreampiesingle workMEYDtameike goroshiro shotenMEYD-675MEYD675meyd00675
    • 2021-05-10

    FC2PPV 1810325 First shot !! Limited number [Uncensored] D cup that has just become a nursery teacher this spring! ︎ Pretty disturbed back face … 2 times vaginal cum shot (feature)

  • amateur uncensoredfc2
    • 2021-05-11
    123 min

    [KTRA-295]Forbidden Tempting Sex With Begging Younger Step Sister Natsu Tojo

  • natsu tojo censoredcreampieuniformKTRAk tribeKTRA-295KTRA295h-094ktra00295
    • 2021-05-11
    127 min

    [KMHRS-043]The Dream Of Meru's Most Devoted Follower: Licking And A First Creampie (Heart) - Meru Kusumi

  • kusumi censoredcreampieamateurKMHRSsod createtiger kosakaikimihoreKMHRS-043KMHRS0431kmhrs00043
    • 2021-05-28
    144 min

    [CLUB-642]I Have A Fetish For School Swimsuits, So I Like To Secretly Film Girls With Big Tits In School Swimsuits. Creampie Sex Using My Horny Cock, From Start To Finish.

  • censoredcreampiebig titsCLUBhentai shinshi clubCLUB-642CLUB642club00642
    • 2021-06-04
    120 min

    [JUL-602]Madonna Popular Exclusive Shame Series First Appearance! Woman Is Made To Cum Over And Over By A Man She Despises... Kana Mito

  • kana mito censoredmature womansingle workJULmadonnajo asagiriJUL-602JUL602jul00602
    • 2021-06-26
    160 min

    [LULU-079]This Beautiful Wedding Planner Gave The Groom A Deep Throat 3D Blowjob That He Could Never Get From His Wife, And Showed Off Her Amazing Technique In A Display Of Her Powerful Cum Swallowing Semen-Sucking SK**ls Yumi Saeki

  • yuka saeki censoredcreampiesingle workLULUlunaticsvagmanLULU-079LULU079lulu00079
    • 2021-07-07
    51 min

    ORETD-886 Miyazaki-san

  • amateur censoredcreampieuniformoretdoretd-886oretd886oretd-886
    • 2021-07-09
    120 min

    [MEYD-689]Gear Change Pussy-to-Mouth Fuck Leaves Him Ejaculating in Agony! Horny Married Woman's Mach Cowgirl and Slow Vacuum Blowjob. Mikako Horiuchi.

  • mikako horiuchi censoredcreampieblowjobMEYDtameike goroMEYD-689MEYD689meyd00689
    • 2021-07-10
    134 min

    [BADA-018]Married Woman Wants A Lover, Arisa Hanyu

  • arisa hanyu arisu hanyu censoredcreampiesingle workBADAbaltanusubashisuidiamondBADA-018BADA018bada00018
    • 2021-07-14
    175 min

    [DVDMS-689]Kiu Aihara Finally Ready For Creampie Sex - 3 Full Fucks, 8 Loads - 18-Year-Old College Girl's First Experiences With Raw Sex

  • aihara tsukiha censoredcreampiebeautiful girlDVDMSdeep sfunky hasegawaDVDMS-689DVDMS689dvdms00689
    • 2021-08-10
    480 min

    [MUCH-135]10 Girls With Top Class Bodies Getting Fucked One After The Next, Volume 3, 8 Hours, 2 Disc Set

  • miki hazuki sara saijo censoredbig titsMUCHmothermuchimuchiMUCH-135MUCH135h-796much00135
    • 2021-08-16
    81 min

    [MISG-001]Starting Today, No More Premature Ejaculation For Me!! - Make Japan Happy With The Power Of Daydream -

  • shinoda yu otsuki sound censoredcreampiebig titsMISGstimulation strongjohnny shibuyaMISG-001MISG001misg00001
    • 2021-08-17
    46 min

    FC2PPV 2039438 Business Trip Men’S Esthetic ＃ 2 G Cup Aisa Full Op + Back Op And It Became Just A Gonzo W (Review Privilege Overseas Version Of The Main Part + Photo Book)

  • amateur uncensoredfc2
    • 2021-09-03
    149 min

    [HODV-21605]Adultery Suits Her Just Fine: The Private Lives Of Naughty Girls Better Off As Mistresses Maebi Kuru

  • coming shrimp censoredcreampiebig titsHODVh m pHODV-21605HODV216055642hodv21605
    • 2021-09-04
    133 min

    [GMEM-042]ULTRA SWEET Akagai Bishoujo Senshi Flaming Lewd Training -Small Devil Lewd Juice Spewing Orgasm Panic Hell- Yuri Fukada

  • yuri fukada censoredsingle workGMEMavsbaba za babiiavscollector s goldGMEM-042GMEM042gmem00042
    • 2021-09-10
    126 min

    [BANK-053]Is This Naughty And Haughty Girl Cumming!？ A Super Cute Shaved Pussy Slender And Beautiful Gal Rika Aohitsugi

  • ao coffin censoredcreampieuniformBANKma ko ginkouyuuseiBANK-053BANK053h-1495bank00053
    • 2021-09-10
    101 min

    [VEMA-169]Overly Nice And Modest Office Lady Ms. Saeki Is A Secret Big Dick Crazed Horny Wife That Doesn"t Even Hate A Creampie. Yumi Saeki ka

  • yuka saeki censoredcreampiemature womanVEMAvenuskaniemegami venusVEMA-169VEMA169vema00169
    • 2021-09-23
    122 min

    [GS-405]Overly Erotic College S*****t Is Too Sexy For The Dad Who Wants To Fuck Her

  • censoredcreampieGSsosoru garcontanburaGS-405GS4051gs00405
    • 2021-10-01
    125 min

    [MILK-121]Step-dad Loves It! No Way Step-mom Can Know He"s Having Lewd Fun Each Day With Nanami. Nanami Yokomiya

  • yokomiya nanami censoredschoolgirlbeautiful girlMILKmilkMILK-121MILK121h-1240milk00121
    • 2021-10-08
    191 min

    [UMD-799](Daily Erotica) I Just Happened To Cum Upon A Dream-Cum-True Erotic Situation, And Usually I Would Never Get To Fuck A Girl Like This, But Here We Present To You A Lucky Fuck (6 Stories) 3

  • riho fujimori jinguji temple nao censoredbig titshandjobUMDleotabu oosakiUMD-799UMD799125umd00799
    • 2021-10-29
    119 min

    [SHKD-976]4-Timing Neat And Clean Bitch Revenge Fuck Orgy Tsumugi Akesato

  • akari tsumugi censoredcreampiebeautiful girlSHKDattackersmaeda bungoushi yoru akuSHKD-976SHKD976shkd00976
    • 2021-11-02
    58 min

    188HINT-0490 Nobuko

  • amateur censoredamateurmature womanhinthint-0490hint0490188hint-0490
    • 2021-11-11
    123 min

    [FSDSS-316]Cum Dumpster Wants Me Too Much Can"t Make A Wife Of This Bitch Intense Erotic SEX Hiyori Yoshioka

  • hiyori yoshioka censoredsquirtingsingle workFSDSSfalenoarashiyama michirufaleno starFSDSS-316FSDSS3161fsdss00316
    • 2021-11-19
    142 min

    [HMN-083]All Episodes Feature Completely Raw Fucking And Orgasmic Awakenings, Totally Uncut Intermingling Pussy Juices, Semen, And Bodily Fluids Raw, Deep And Rich Creampie Sex Hitomi Hoshiya

  • hitomi hoshitani censoredcreampiesingle workHMNhonnakamonHMN-083HMN083hmn00083
    • 2021-12-11
    197 min

    [DGCEMD-097]*For Streaming Editions Only! Cums With Bonus Footage* A Maid Will Lure You To Temptation In Her Thong! Mina Kitano A Horny Maid Will Milk You Of Your Semen With Her H-Cup Colossal Tits And Her Thong-Strapped Ass!

  • mina kitano censoredcreampiebig titsDGCEMDceleb no tomoDGCEMD-097DGCEMD097dgcemd00097
    • 2021-12-17
    76 min

    [HEYZO-2690]Ena Requesting The POV Fuck Option -Yokohama-

  • ena uncensoredheyzo
    • 2021-12-21
    38 min

    FC2PPV 2534788 [For A Limited Time In Translation] The Video Was Shot Half A Year Ago, But It Has Been Discontinued … As A Result Of Discussions, Her Permission Was Finally Obtained And Released. A Problematic Work With A Complete Appearance! !!

  • amateur uncensoredfc2
    • 2021-12-24
    70 min

    FC2PPV 2540027 [No] [Complete First Shot] Meet At Ti ● Der !？ A Ruthless Vaginal Cum Shot That Picks Buds From A Talented Artist’S Egg [Main Story About 2 Hours And 45 Minutes] 13)

  • amateur uncensoredfc2
    • 2022-01-10
    90 min

    300MIUM-786 Go On A Pheromone Ol And A Sabotage Trip With A Godly Balance Of Flesh And Constriction! I Thought He Was A Solid Common Sense Person … It’s A Super Carnivorous System ● This Is Hot And Ready At Any Time Www I’m Completely

  • amateur censoredcreampiebig titsmiummium-786mium786300mium-786
    • 2022-01-18
    67 min

    [324SRTD-0267]真ん丸お乳が最高のIカップ女子に無断中出し

  • amateur censoredcreampiebig titssrtdsrtd-0267srtd0267324srtd-0267
    • 2022-01-21
    123 min

    [ROE-043]An Overflowing Feeling Of Jealousy And A Step Family Relationship That Crosses The Line. Recently, My Step-Mother"s Underwear Has Been Getting Gaudy... Amano Rumi

  • rumi amano censoredmature womanmomROEmadonnahiroyuki kimuramonroeROE-043ROE043roe00043
    • 2022-01-21
    213 min

    [HUNTB-192]"You Said I Can Put It In Your Mouth？" My Stepmom Is Worried About Me When I"m Feeling Down For Premature Ejaculation Issues, So She Gives Me A Handjob And Blowjob To Help Train Me Not To Cum Too Fast! Her Mouth...

  • censoredcreampieblowjobHUNTBhunterkoichi davidsonhhh groupHUNTB-192HUNTB192huntb00192
    • 2022-01-22
    141 min

    [DBER-138]Beast-Crazy Narcotics Investigator-case-008: Miho Kurusu"s Case: A Trap Of Infiltration! The Aria Of Hell Played By The Female Body Of A Fireman Hinata Mio

  • hinata clan censoredsingle workDBERbabyentertainmentkikubonred babeDBER-138DBER138dber00138
    • 2022-02-05
    134 min

    [MDS-900]An After School Secret That This Ogre-like Older Man Taught Me - Rena Usami

  • reina usami censoredschoolgirlsingle workMDSuchu kikakusuzutake loves nightclubsMDS-900MDS900mds00900
    • 2022-02-10
    88 min

    [IENF-192]Seeing My Step-niece Again For The First Time In A While, Now She"s A Temptress Slut! Innocently Embraced By My Step-niece. But She"s Older Now And Her Cute Figure Is Super Exciting! Making My Dick Hard When She Straddles It!

  • natural mizuki jinno hina censoredcreampieuniformIENFienergytiger kosakaiienfIENF-192IENF1921ienf00192
    • 2022-02-15
    97 min

    261ARA-527 [Seriously Beautiful Woman] [Accumulating Libido] Eru-Chan Is Here! "Today, Take Care Of Your Boyfriend W" I’m Not Enough To Break Up With My Boyfriend W In Short, I Have A Lot Of Libido ♪ [Transcendent Big Tits] [Haripatsu Ni

  • amateur censoredbig titsamateuraraara-527ara527261ara-527
    • 2022-02-17
    50 min

    H4610 ki220217 Maiko Umeki 26years old

  • amateur uncensoredh4610



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi