devil post creampie javcensored censored




FC2VEMANATRSPRDABWNACRSHKDBBANPREDNNPJNACXJUFEDASDSSISADNSTARSHDKAAWDGVHPPPDFSDSS

2020-12-20
14 min

FC2PPV 1613165 [Individual shooting] Prefectural general course ① 140 cm angel. After playing in the city of longing, two uncles are played with and inserted raw.

  • amateur uncensoredfc2
    • 2020-12-25
    115 min

    [GNAX-042]The Midday Moans She Definitely Doesn't Want Her Husband To Find Out About Mio Kimijima

  • kimishima mio censoredcreampiebig titsGNAXnagiranagira kenzoGNAX-042GNAX042h-1345gnax00042
    • 2020-12-29
    54 min

    200GANA-2408 In the spear room of the Nampa teacher of 100 battles, take in SEX hidden shooting 185 Even if you go to Tokyo, the Kansai dialect does not come off. Maybe it’s because of the kotatsu that shines, or … Excited and desperate for

  • amateur censoredbig titsamateurganagana-2408gana2408200gana-2408
    • 2021-01-01
    239 min

    [ZMAR-032]Totally! Yu Shinoda (ZMAR-032)

  • shinoda yu censoredcreampiebig titsZMARplanet plusthe whole damn thingZMAR-032ZMAR032h-237zmar00032
    • 2021-01-01
    77 min

    [FTBL-008]Check Out Her Beautifully Small Waist And Those Charming Asses, Wrapped In Deep Red Thongs As Hot As Porsches! A G-Cup Titty Beautiful Babe Who Looks Like A Model! As She Shakes Her Ass Up And Down And Bending That Vibrator, She's Worki

  • censoredbig titsFTBLfalenodavielfalenotubeFTBL-008FTBL0081ftbl00008
    • 2021-01-02
    41 min

    [opcyn-144]あむ(21)

  • amateur censoredcreampiebig titsopcynopcyn-144opcyn144opcyn-144
    • 2021-01-09
    55 min

    C0930 ki210110 Misuzu Okazaki 22years old

  • amateur uncensoredc0930
    • 2021-01-13
    43 min

    FC2PPV 1642758 [Appearance / Uncensored / Cheating NTR] God Fcup Beauty Witch NTRw who loves each other with super rich SEX with other married women Complete service & seeding cum shot at the woman on top posture! Cowgirl tech w of a beautiful wi

  • amateur uncensoredfc2
    • 2021-01-13
    45 min

    302GERK-345 Miss Chie

  • amateur censoredcreampiebig titsgerkgerk-345gerk345gerk-345
    • 2021-01-21
    124 min

    [GS-373]I Injured My Leg, And During My Hospitalization, There Was This Sexy And Tantalizing Nurse, And I Was Otherwise Fit As A Fiddle And Full Of Cum, And I Could No Longer Resist!

  • censoredcreampieuniformGSsosoru x garconspada ikebukuroGS-373GS373h-101gs00373
    • 2021-01-25
    234 min

    [MJBB-001]Girls From The Minato Ward: Arrogant Girls With Sopping Wet Pussies From The Minato Ward - POV Video

  • censoredbig titsamateurMJBBminato ward girlsMJBB-001MJBB001h-1554mjbb00001
    • 2021-01-30
    56 min

    [HHKL-083]She Crashed At My Place After A Party, So I Tried Hitting On Her And You Won't Believe What Happened. Yukine Amasawa

  • yukine amazawa censoredHHKLhunterkawajirihhh groupHHKL-083HHKL083hhkl00083
    • 2021-01-30
    152 min

    [MIDE-876]Rough G*******g Sex With A Female Teacher - Rough Deep Throat/Group Shaming - Nana Yagi

  • nana yagi censoredblowjobsingle workMIDEmoodyzbungo maedamoodyz divaMIDE-876MIDE876mide00876
    • 2021-02-03
    120 min

    [GVH-186]Boob Lover Shota-kun's Lewd Prank - Mio Kimishima/Honoka Tsujii

  • kimishima mio tsujii honoka censoredbig titsGVHglory questtorindoru tanakaGVH-186GVH18613gvh00186
    • 2021-02-06
    40 min

    FC2PPV 1674425 [Junior-kun ③] Tsundere beautiful breasts G cup is fucked by a big cock and vaginal cum shot “An! Agu … No!”

  • amateur uncensoredfc2
    • 2021-02-06
    182 min

    [NKKD-195]Car Camera Cheating 17 - The Drive Recorder Catches Everything

  • censoredmature womanNKKDjet eizomanji groupNKKD-195NKKD195nkkd00195
    • 2021-02-14
    134 min

    [ARM-953]Military Fangirls X Thighjob

  • star ameri hasegawa moko censoredcosplayslutARMaromashigeo kakuwakiARM-953ARM953arm00953
    • 2021-02-17
    72 min

    [opcyn-151]あやせ(20)

  • amateur censoredbig titsamateuropcynopcyn-151opcyn151opcyn-151
    • 2021-02-22
    116 min

    [ANZD-066]Her First Sugar Daddy Hunt - A Maso And Secretly Horny Intellectual Babe, Miku-chan (J-Cup Titties) -

  • censoredcreampiebig titsANZDapricotANZD-066ANZD066anzd00066
    • 2021-03-11
    161 min

    [MIST-330]Private Titty Bar After Her Store Closed Down One Of The Women Contacted Me And Asked To Meet For Money...She Let Me Touch Her Tits And Cum Inside Of Her As Long As The Store Didn't Find Out! Sana Sanada

  • sanada sanada censoredbig titsMISTmr michirusaitaMIST-330MIST3301mist00330
    • 2021-04-01
    70 min

    FC2PPV 1750583 [Individual shooting] ＃ 45 Idol face ass J 〇 and after-school sex Premature ejaculation with too good sensitivity 〇 Plenty of raw chicks in and out [Leaked] [Limited]

  • amateur uncensoredfc2
    • 2021-04-11
    47 min

    FC2PPV 1764451 [First shot] That girl who has a cute feeling of being a little stretched was the first experience of vaginal cum shot ♥♥

  • amateur uncensoredfc2
    • 2021-04-13
    58 min

    299EWDX-357 A transparent black strike and huge breasts invite a man. Libido contrary to the innocent face!

  • amateur censoredcreampiebig titsewdxewdx-357ewdx357299ewdx-357
    • 2021-04-15
    65 min

    336KNB-150 I Can’t Be Satisfied With Sex With My Husband And Apply For AV! Contrary to the appearance that seems to be an adult, the sensitivity is good and the intense erotic reaction! !! A mysterious wife who trembles with a pleasant sensation

  • amateur censoredbig titsmarried womanknbknb-150knb150336knb-150
    • 2021-04-22
    21 min

    HEYZO 2503 Anna’s Amazing Hand Job – Anna Honda

  • anna honda uncensoredblowjobhandjobheyzo
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-11
    58 min

    H0930 ki210511 Noriko Kakei 34years old

  • amateur uncensoredh0930
    • 2021-05-29
    267 min

    [HMJM-056]Super Best 4 Hours - Aoi Tojo

  • tojo censoredbig titsHMJMhmjmcompany matsuoHMJM-056HMJM056h-172hmjm00056
    • 2021-06-04
    86 min

    [ETQR-243](Breaking In POV) Married Woman Wants To Get Knocked Up By A Massive Cock Karina, Age 33

  • censoredcreampiemarried womanETQRerotic timeETQR-243ETQR243etqr00243
    • 2021-07-09
    92 min

    483SGK-032 [Endless Saddle Tide GAL] [Three consecutive vaginal cum shots] [Cute but too cute minimum extreme girl] [Big cock lover] [Yariman apparel clerk] Cute! Erotic! Saddle tide! Creampie! Is an endless looping duero blonde GAL! !! ︎ 100 shots a

  • amateur censoredcreampiesquirtingsgksgk-032sgk032483sgk-032
    • 2021-07-20
    180 min

    [KIR-040]Apartment Wife: 180 Minutes Of A Beautiful Sexually Frustrated Body

  • yurika waka ninomiya censoredcreampiebig titsKIRstar paradisekirei star paradiseKIR-040KIR040h-254kir00040
    • 2021-08-28
    57 min

    H4610 tk0041 Aki Osagawa 20years old

  • amateur uncensoredh4610
    • 2021-08-30
    53 min

    229SCUTE-1127 Mao (21) S-Cute Facials On A Uniform Girl Who Blows Tide With M Character Sex

  • amateur censoredsquirtinguniformscutescute-1127scute1127229scute-1127
    • 2021-09-18
    111 min

    [DDHZ-012]My Wife Is A Witch Of Nipple Play. My Wife Became A Popular Nipple Teasing Fudol And I Didn"t Even Know It. Kanna Hirai

  • shiori hirai censoredslutsingle workDDHZdogmano maru kimore no hitodzumaDDHZ-012DDHZ012ddhz00012
    • 2021-09-23
    170 min

    [NHDTB-582]Sensitive Woman With Big Tits Is Soaking Wet And She Comes In the Cowgirl Position With Bouncing Tits

  • censoredbig titsNHDTBnatural highraftin maeshiroNHDTB-582NHDTB5821nhdtb00582
    • 2021-09-24
    70 min

    FC2PPV 2245031 * Limited Time Price & Bonus * [Gal Bitch Young Wife] Hairdresser Wife 28 Years Old Slender G Cup Married Woman Who Is Not Enough To Play Is Cheating Gonzo With Customers. Gachi Convulsions Acme Creampie Squeezing Semen At Slut Cowg

  • amateur uncensoredfc2
    • 2021-10-09
    124 min

    [KAGP-197]Crisp Close-ups Of Pussy And Anal 2. Amateur Girls For Super Close-up Masturbation Scenes, 12 Performers.

  • censoredamateurbeautiful girlKAGPkaguya hime pt mousozokutsumatori no okinakaguya hime ptKAGP-197KAGP197kagp00197
    • 2021-10-18
    82 min

    259LUXU-1454 Luxury TV 1471 A Pianist With An Attractive Plump Glamorous Body With An Adult Sex Appeal Appears In AV In Search Of A New World! The Body That Has Begun To Ripen Sensually Is Outstandingly Sensitive! The Pant Voice That Echoes Annoyingl

  • amateur censoredbig titsamateurluxuluxu-1454luxu1454259luxu-1454
    • 2021-10-22
    146 min

    [HMN-067]At The Creampie Bath House, The Girls Always Let Me Ride And Cum Bareback More Than Once Ichika Seta

  • kazuhana seta censoredcreampiebig titsHMNhonnakazack araiHMN-067HMN067hmn00067
    • 2021-10-22
    117 min

    [OPKT-031]Forbidden Pregnancy Creampie Allowed At Work, Chisato Mochizuki

  • chisato mochizuki censoredcreampiebig titsOPKTtoyohikotoyohikotoyohiko kikakuOPKT-031OPKT031opkt00031
    • 2021-10-23
    146 min

    [PCDE-013]A Video Record Of The Activities Of A Certain Otaku 13

  • igarashi yui natsuhara censoredcosplayPCDEcp denen mousouzokucp denentoaru otaku no katsudou kirokuPCDE-013PCDE013pcde00013
    • 2021-11-01
    122 min

    [AMBI-143]Three Days With Unrelated Sister-in-law! Had Continuous Sex Saying "Touch Here!!" Miina Konno

  • miina konno censoredcreampiebig titsAMBIplanet plusdirector oanbibarentsuAMBI-143AMBI143h-237ambi00143
    • 2021-11-04
    165 min

    [ABW-162]美ノ嶋めぐりの極上筆おろし 43 童貞ガチ素人3名全員マ●コで卒業！！射精率100【MGSだけのおまけ映像付き 15分】

  • amateur censoredamateurcosplayabwabw-162abw162abw-162
    • 2021-11-05
    120 min

    [IPX-751]She Cums 129 Times, Convulses 132 Times, And Squirts 7100ml! Experience The Upper Limit Of Trance Fucking Fantasy - Mai Kanami

  • kanna mimai censoredsquirtingsingle workIPXidea pocketinnabartissueIPX-751IPX751ipx00751
    • 2021-11-05
    17 min

    FC2PPV 2404666 [Weekend Limited Release] Wife’s Daytime Cheating Video Robbed From Cheating Partner: Wife Who Refuses Even If She Asks For Sex Spills A Man’s Big Cock At Home [cen]

  • amateur uncensoredfc2
    • 2021-12-07
    58 min

    FC2PPV 2464328 [Personal Shooting] Chiharu 21 Years Old Neat System Plump Big Butt Dirty Female College Student Launches A Large Amount Of Raw Squirrel

  • amateur uncensoredfc2
    • 2021-12-25
    65 min

    383MONA-003 Metropolitan Ordinary Course K3 Nagi-Chan (1 ●) Outflow Of Appearance (Nagi Mamiya)

  • amateur censoredcreampieamateurmonamona-003mona003383mona-003
    • 2022-01-07
    141 min

    [JUL-822]Neighborhood Camping Cuckholdry Shocking Footage Of A Wife Being Fucked Raw Inside A Tent Rena Kodama

  • kodama rena censoredcreampiebig titsJULmadonnamametaro mamezawaJUL-822JUL822jul00822
    • 2022-01-14
    88 min

    [VEMA-174]My Beautiful Female Teacher Is Also My Club Advisor, And Also My Girlfriend And Lover - Forbidden, Passionate Creampie Sex, From Morning To Night, With My Older Girlfriend - Misono Mizuhara

  • suwon miso censoredcreampiebig titsVEMAvenuspetermegami venusVEMA-174VEMA174vema00174
    • 2022-01-27
    68 min

    FC2PPV 2627057 * Limited Price [Appearance] Idol Trainee, SS-Class Beauty With Beautiful Big Breasts On A Body Tightened By Dance [cen]

  • amateur uncensoredfc2
    • 2022-02-03
    130 min

    [FANH-065]Miraculous Beautiful Mature Female Office Worker Kyoko , A Naive Girl With Beautiful Big Tits Who Is Engaged To Be Married, Soaks Her Dick In The Water.

  • censoredcreampiesquirtingFANHhamedori.network secondeditionFANH-065FANH065h-1472fanh00065
    • 2022-02-08
    482 min

    [MUCH-146]Chubby Girls With Colossal Tits 10 Girls, Back-To-Back Sex 8 Hours, 2 Discs

  • ayu noharu enomiya censoredbig titsMUCHmothermuchi mutchiMUCH-146MUCH146h-796much00146
    • 2022-02-26
    120 min

    [KSBJ-184]The Newly-Wed Niece Who Seduces Her Step-Uncle. Ena Kome

  • ena koume censoredcreampieslutKSBJksb kikaku emmanuellebito sakuraKSBJ-184KSBJ184ksbj00184
    • 2022-02-27
    87 min

    481SACZ-101 Hana (Kana Hana)

  • amateur censoredamateurbdsmsaczsacz-101sacz101481sacz-101
    • 2022-03-12
    76 min

    534IND-040 A Small Devil Girl With A Loli Voice Pretending To Be An Orthodox Beautiful Girl. Recording From Continuous Exploitation To ●● Play (Nanami Yokomiya)

  • amateur censoredcreampieamateurindind-040ind040534ind-040
    • 2022-03-20
    55 min

    300NTK-701 [New Era Spear Man Beauty Bitch Advent] [Erotic Whip Beauty Of Cum Swallowing] [Wanko Blowjob Removal & Vaginal Squeezing 5 Shots! !! ] Now Is The Time To Decide The Reiwa No. 1 Yariman Of The New Era Bitch Of Bitch! !! The One Who Cut

  • amateur censoredcreampiebig titsntkntk-701ntk701300ntk-701



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi