digital mosaic jav slut javcensored censored




FC2DTTNACXMIAAAMBIAWDHMNAVSASHKDGVHHNDMEYDNACRHODVHUNTBNATRWAAAMARAAPODAUKGMIDE

2019-10-06
151 min

[IPX-387]A Beautiful Girl Slut Who Loves Dirty Old Men Is Luring Their Middle-Aged Cocks To Ejaculation Through Teasing Pull Out Licking And Sucking Sex Minami Aizawa

  • minami aizawa censoredbeautiful girlslutIPXidea pocketk westtissueIPX-387IPX387ipx00387
    • 2019-10-03
    159 min

    [PRED-185]The Bride Of A Sadistic Family (That's Me) In A Newly Wed Lifestyle Of 24 Hours Of Ejaculation Management Aika Yamagishi

  • aika yamagishi censoredslutsingle workPREDpremiumichiro kanedaelegancePRED-185PRED185pred00185
    • 2019-10-03
    119 min

    [PRED-189]After Having Babymaking Sex, I'm Being Lured To Creampie Temptation By My Big Sister-In-Law. Amy Fukada

  • emi fukada censoredcreampieslutPREDpremiumtrendy yamaguchielegancePRED-189PRED189pred00189
    • 2019-09-28
    164 min

    [MIDE-687]If You Have A Hard Time Cumming, This One Is For You!! A Delayed Ejaculation Clinic Serviced By An Amazingly Skilled Slut - She Has Miraculous Ejaculation Skills That Will Make You Feel Multiple Times Better - Minami Hatsukawa

  • hatsukawa minami censoredsluthandjobMIDEmoodyzwild sevenmoodyz divaMIDE-687MIDE687mide00687
    • 2019-09-28
    166 min

    [MIRD-194]One Day, My Dad Got Remarried To A Legendary Porn Actress - Full-On Sex With Genius Sisters - The Temptation Never Ends

  • mitani akari yui hatano censoredcreampieslutMIRDmoodyznao masakimoodyz realMIRD-194MIRD194mird00194
    • 2019-09-28
    119 min

    [MIAA-158]Splish! Splash! Unlimited Creampie Sex And Wetting Yourself With Semen! Welcome To The Orgasmic Squirting Soapland Yu Shinoda

  • shinoda yu censoredcreampiebig titsMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-158MIAA158miaa00158
    • 2019-09-28
    120 min

    [MIAA-161]"Hey, Will You Come To My Room Tonight？" I'm Being Cowgirl Fucked By My Neighbor With The Big Ass, Two Of Them, Every Day. 2 Yu Shinoda Yui Hatano

  • shinoda yu yui hatano censoredslutMIAAmoodyzMIAA-161MIAA161miaa00161
    • 2019-09-28
    159 min

    [MIAA-160]Pantyhose Squeeze Huge Ass Secret Club

  • otsuki sound miku abe censoredslutMIAAmoodyzhatatai ryoeveryone s porn starMIAA-160MIAA160miaa00160
    • 2019-09-22
    149 min

    [TCD-238]Would You Like To Have Ass Pussy Sex With A Cute Cosplay She-Male & Reverse Anal Sex？ An Exclusive She-Male Actress Azusa Himeyuri

  • himeyuri censoredcosplayslutTCDtrans clubTCD-238TCD238tcd00238
    • 2019-09-21
    119 min

    [JUY-979]I'm A Newcomer Who Keeps Messing Up All The Time, Currently Working For a Younger Female Boss Eimi Fukada

  • emi fukada censoredmature womanslutJUYmadonnatakeshi kogaJUY-979JUY979juy00979
    • 2019-09-21
    123 min

    [HND-725]A Slutty Older Sister Goes In For Some Serious Nipple Play And Begs To Get Creampied, Using Her Pussy To Squeeze One Cock After Another - Nanami Matsumoto

  • nana matsumoto censoredcreampiebig titsHNDhon nakamiyoshi rusherHND-725HND725hnd00725
    • 2019-09-21
    146 min

    [JUY-986]She'll Grab You From Behind, Enjoy Tied Up Cunnilingus, Foot Job Interrogations... The Investigator Will Never Let You Go Once She Has You In Her Grasp Reiko Sawamura

  • reiko sawamura honami takasaka masumi takasaka censoredmarried womanmature womanJUYmadonnarokusaburo mishimaJUY-986JUY986juy00986
    • 2019-09-21
    152 min

    [HND-723]The Succubus Who Wanted Children She Made Time Stop And Began Cuckold Fucking Away All The Men In The World Away From Their Women With Forced Erections And Consecutive Ejaculations!! "I'm Telling You I Have No Semen Left!" But Ev

  • emi fukada censoredcreampiebeautiful girlHNDhon nakanao masakiHND-723HND723hnd00723
    • 2019-09-21
    120 min

    [JUY-987]If We Get Caught, We're In Big Trouble... While My Wife Was Pregnant, My Big Sister-In-Law Gave Me Whispering Dirty Talk And A Total Coverage Fuck Fest To Drain Me Of Every Last Drop Of Sperm Shoko Akiyama

  • shoko akiyama censoredcreampiemarried womanJUYmadonnaviva gonzoJUY-987JUY987juy00987
    • 2019-09-21
    162 min

    [JUY-985]A Stepmom Wants Her Stepson's Huge Cock So Bad, It's All She Can Think About From Morning Until Night - Yuka Oshima

  • yuka oshima censoredbig titsmarried womanJUYmadonnaichiro kanedaJUY-985JUY985juy00985
    • 2019-09-08
    146 min

    [JUFE-096]I Was Newly Married And On A Business Trip With My Lady Boss When, To My Surprise, We Were Put In The Same Room Together And From Morning Until Night, She Treated Me Like Her Sex Slave In A Reverse Cuckold NTR Situation Amy Fukada

  • emi fukada censoredcreampiebig titsJUFEfitchJUFE-096JUFE096jufe00096
    • 2019-09-08
    151 min

    [IPX-370]Drooling, Spitting, Deep And Rich Kisses And Sex With A Pretty Elder Step-Sister Jessica Kizaki

  • jessica kizaki censoredblowjobslutIPXidea pocketusa pyondishIPX-370IPX370ipx00370
    • 2019-09-08
    120 min

    [IPX-369]This Beautiful Nympho Teacher Will Hit You With Whispering Dirty Talk And Relentless Cowgirl Sex To Lure You To Creampie Pleasure In A Private Lesson Tsubasa Amami

  • amami tsubasa censoredcreampieslutIPXidea pocketjo asagiridishIPX-369IPX369ipx00369
    • 2019-09-08
    120 min

    [MIDE-682]Tsubomi Is A Female Teacher Who Taught Me The Greatest Masturbation Techniques Of All Time JOI & Total POV Sex

  • bud censoredsluthandjobMIDEmoodyzkijin kasaimoodyz divaMIDE-682MIDE682mide00682
    • 2019-09-08
    119 min

    [MIDE-680]My Childhood Friend Is A Plain Jane But The Truth Is She's A Hungry Bitch I Spent 5 Days With Her As She Sexually Devoured Me Sakura Miura

  • minamata sakura censoredbig titsslutMIDEmoodyzmoodyz divaMIDE-680MIDE680mide00680
    • 2019-09-08
    151 min

    [IPX-368]A Budding Total Domain Alluring Temptation A Little Devil Beautiful Young Girl In Uniform And Knee-High Socks Kana Momonogi

  • kana momonogi censoredschoolgirlbeautiful girlIPXidea pocketkirindishIPX-368IPX368ipx00368
    • 2019-09-08
    149 min

    [MIAA-153]"It's Okay If I Just Suck Your Cock, Right？" Every Day They Use Their Mouthpussies To Suck Their Neighbor's Cock Dry. Their Husbands Don't Pay Attention To Them, So These Married Woman Seek Satisfaction Somewhere Else...

  • hasumi claire rino kirishima censoredbig titsblowjobMIAAmoodyzsuisei akaieveryone s porn starMIAA-153MIAA153miaa00153
    • 2019-09-08
    150 min

    [MIDE-681]She's Luring You With Her Panties Off From The Other Side Of That Mirror A Beautiful Girl At A Reflexology Parlor Who Wants To Service You With Secret Options (Like Sex) Mia Nanasawa

  • nanasawa mia censoredschoolgirlbeautiful girlMIDEmoodyzhirokoji osakimoodyz divaMIDE-681MIDE681mide00681
    • 2019-09-08
    185 min

    [JUNY-013]A Secretly Colossal Tits Beautiful Young Girl In Uniform Is Working An After School Creampie Amateurs Part-Time Job Waka Misono

  • misono waka censoredcreampiebig titsJUNYfitchnikuyokuJUNY-013JUNY013juny00013
    • 2019-09-05
    119 min

    [JUY-968]My Dildo. Ayane Haru

  • ayane haruka censoredmature womanslutJUYmadonnanagaeJUY-968JUY968juy00968
    • 2019-09-05
    118 min

    [PRED-180]Non-Stop Blowjobs With A Former Local News Anchor - She Gets Cum In Her Mouth 10 Times! - Yuki Takeuchi

  • yuki takeuchi censoredblowjobslutPREDpremiumkogoro kindaichielegancePRED-180PRED180pred00180
    • 2019-09-05
    166 min

    [JUY-961]Top Class Beautiful Actresses Unite For The Ultimate Luxury Experience! A Threesome With Two Horny Women Vs. One Shy Guy At A - 170 Minutes

  • hojo asahi namiki touko censoredmature womanslutJUYmadonnamametaro mamezawaJUY-961JUY961juy00961
    • 2019-09-05
    120 min

    [PRED-184]Big Bootied Bookworm Gets Banged Cowgirl Style Aoi Kururugi

  • aoi kururugi censoredcreampieslutPREDpremiumsapporo taroelegancePRED-184PRED184pred00184
    • 2019-09-05
    119 min

    [PRED-181]How I Turned My Sweet and Innocent Little Sister Into A Cum Guzzling Monster. Eimi Fukada

  • emi fukada censoredcreampiebig titsPREDpremiumsuisei akaielegancePRED-181PRED181pred00181
    • 2019-08-31
    153 min

    [MIAA-142]I'm Going To Tweak Your Nipples Today!! A Twisting And Turning Slut Tweaking Good Time! Don't Pull Out! She's Squeezing Tight The Whole Time While Fucking Miku Abeno Shuri Atomi

  • miku abe atomi shuri censoredslutMIAAmoodyzgoemoneveryone s porn starMIAA-142MIAA142miaa00142
    • 2019-08-31
    118 min

    [MIAA-147]The Midsummer Hard And Tight Sweaty Night Bus - The Intellectual Girl From Next Door Is Using Her Big Ass To Cowgirl Ride Me And Keep Me Cumming In One Memorable Night - Mitsuki Nagisa

  • scooping censoredbeautiful girlslutMIAAmoodyzham the mceveryone s porn starMIAA-147MIAA147miaa00147
    • 2019-08-24
    146 min

    [JUY-946]I Got A New Job And Became The New Fresh Face In The Office, And Now My New Lady Boss And I Are Fucking All Day During Work Reiko Sawamura

  • reiko sawamura honami takasaka masumi takasaka censoredmature womanslutJUYmadonnatakeshi kogaJUY-946JUY946juy00946
    • 2019-08-24
    152 min

    [HND-714]My Girlfriend's Sister Loves Me So Much, She Wants To Have My Babies - Ruka Inaba

  • inaba censoredcreampiebig titsHNDhon nakausa pyonHND-714HND714hnd00714
    • 2019-08-24
    148 min

    [JUY-951]The Slutty Wife Next Door Made Me Cum In A Variety Of Different Ways Over The Course Of One Week - Maki Tomoda

  • maki tomoda censoredbig titsmature womanJUYmadonnatakeshi kogaJUY-951JUY951juy00951
    • 2019-08-24
    124 min

    [HND-717]This Elder Sister Slut Will Lure You To Creampie Ejaculation Through Amazing Nipple Tweaking Toka Rinne

  • roaring sound censoredcreampiebig titsHNDhon nakamiyoshi rusherHND-717HND717hnd00717
    • 2019-08-24
    119 min

    [HND-718]This Slut Is Living With 21 Single Men At This House Please Spend A Day Here And Become Our Creampie Manager Akari Mitani

  • mitani akari censoredcreampieslutHNDhon nakahiroaHND-718HND718hnd00718
    • 2019-08-24
    147 min

    [HND-712]His Girlfriend Was Close By, But She Whispered Sweet Seductions Into His Ear For Creampie Temptation Amy Fukada

  • emi fukada censoredcreampieslutHNDhon nakanao masakiHND-712HND712hnd00712
    • 2019-08-16
    119 min

    [MVSD-397]I Went On A Business Trip And Was Staying At A Rustic Old Hot Springs Inn, And To My Surprise, I Was Placed In The Same Room As This Newly Graduated Female Associate For Some Reverse NTR Action She Shook Her Ass So Furiously That I Was Forc

  • akari neo censoredcreampiebeautiful girlMVSDm s video groupMVSD-397MVSD397mvsd00397
    • 2019-08-10
    170 min

    [MIDE-676]A Young Girl Gets Possessed By A Succubus While Her Parents Are Away And Copulates For 3 Days Straight - Tsubomi

  • bud censoredslutsingle workMIDEmoodyznao masakimoodyz divaMIDE-676MIDE676mide00676
    • 2019-08-10
    150 min

    [IPX-361]Debut Riona Kotomiya True Slut! A Genius Of Real Sex!

  • rina kotomiya censoredsquirtingsingle workIPXidea pocketmon cdishIPX-361IPX361ipx00361
    • 2019-08-10
    180 min

    [MIAA-134]This Is The Story Of What Happened When I Went To A Sex Club And Out Came This Intellectual Girl And She Hit Me With Some Unbelievably Amazing Technique Aoi Kururugi

  • aoi kururugi censoredslutsingle workMIAAmoodyzcaptain eharaeveryone s porn starMIAA-134MIAA134miaa00134
    • 2019-08-10
    161 min

    [IPX-352]This Beautiful Young Girl Likes To Get Older Men In A Position Where They Can't Resist And Ride Them Like A Slut - Karen Kaede

  • karen kaede censoredbeautiful girlslutIPXidea pocketbungo maedadishIPX-352IPX352ipx00352
    • 2019-08-10
    180 min

    [MIRD-191]Enjoy A Healing Massage With Miraculous Nipple Play - These Girls Will Provide Relaxation And Stimulation All At Once!!

  • shinoda yu aika censoredslutMIRDmoodyzgoemonmoodyz realMIRD-191MIRD191mird00191
    • 2019-08-10
    157 min

    [JUFE-087]My Girlfriend Is Right Next To Me But Her Nerdy Little Sister Seduces Me With Her Huge Tits And Dirty Talk - Ruka Inaba

  • inaba censoredcreampiebig titsJUFEfitchJUFE-087JUFE087jufe00087
    • 2019-08-10
    211 min

    [HJMO-411]The Couples' Challenge: If This Lucky Husband Can Withstand Wife Shiori Kamisaki 's Masterful Fuck For 20 Minutes, He Wins! But If She KO's His Cock Twice, Her Pussy Gets Pumped With Some Other Guy's Cum!

  • shiori kamisaki censoredcreampiebig titsHJMOhajime kikakuhajimeHJMO-411HJMO411hjmo00411
    • 2019-08-10
    150 min

    [JUFE-088]I've Been Saving Up My Cum For A Month To Try And Get My Wife Pregnant... But Her Sexually Frustrated Sister Came Out From Left Field With Colossal Tits And No Bra To Seduce Me - Maria Nagai

  • maria nagai censoredcreampiebig titsJUFEfitchJUFE-088JUFE088jufe00088
    • 2019-08-03
    146 min

    [JUY-931]Mother-In-Law Wants Her Son-In-Law's Massive Cock 24 Hours-A-Day - Ayane Haruka

  • ayane haruka censoredmature womanslutJUYmadonnakogoro kindaichiJUY-931JUY931juy00931
    • 2019-08-03
    120 min

    [PRED-169]She Was So Busy She Didn't Have Time To Hook Up With Her Boyfriend Or Her Fuck Buddy This Animalistic Elder Sister Is So Horny That She's Finally Reached Her Sexual Limit. She Caught Sight Of Her Little Brother-In-Law's Cock (Th

  • roaring sound censoredcreampiebig titsPREDpremiumcontour styleelegancePRED-169PRED169pred00169
    • 2019-08-03
    119 min

    [JUY-930]Rei Aoki Shows Off Her Suntanned Body!! She's A Married Fitness Instructor Who Tempts Men With Her Healthy Brown Skin

  • rei aoki censoredmature womanslutJUYmadonnarokusaburo mishimaJUY-930JUY930juy00930
    • 2019-08-03
    120 min

    [PRED-172]An Elegant Saleswoman Seduces You With Her Surprisingly Slutty Thongs - Aika Yamagishi

  • aika yamagishi censoredslutlingeriePREDpremiumsapporo taroelegancePRED-172PRED172pred00172
    • 2019-08-03
    116 min

    [PRED-175]I'll Protect You From The Bullies, So In Exchange I Want You To Be My After School Sex Slave Amy Fukada

  • emi fukada censoredcreampiebig titsPREDpremiumzaku araielegancePRED-175PRED175pred00175
    • 2019-07-27
    119 min

    [MIAA-129]The Elder Sister Of The Bride Was Secretly Luring The Groom To Temptation And Mounting Him With Her Big Ass While Her Little Sister Was Waiting Nearby Yu Shinoda

  • shinoda yu censoredbig titsslutMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-129MIAA129miaa00129
    • 2019-07-27
    181 min

    [MIDE-671]BDSM Freak Minami Hatsukawa Lures Men Into Her Suite, Ties Them Up And Makes Them Cum! For 24 Hours, There's No Escape!

  • hatsukawa minami censoredbeautiful girlslutMIDEmoody snanzaki masakimoodyz divaMIDE-671MIDE671mide00671
    • 2019-07-27
    159 min

    [MIAA-124]Beautiful Legs Temptation High-Cut MANIAX Toka Rinne

  • roaring sound censoredbig titsslutMIAAmoody sdragon nishikawaeveryone s kikatanMIAA-124MIAA124miaa00124
    • 2019-07-27
    117 min

    [MIAA-123]Sex Workers Academy Festival - A Slutty Gal In Uniform Gives You The Full Course - AIKA

  • aika censoredcreampieslutMIAAmoody sconcave styleeveryone s kikatanMIAA-123MIAA123miaa00123
    • 2019-07-27
    154 min

    [MIAA-126]A Bodybuilding Slut Goes On Camera, Flexing Her Sexual Muscle - EMI

  • censoredhandjobMIAAmoody swild seveneveryone s kikatanMIAA-126MIAA126miaa00126



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi