documentary jav def censored javcensored




FC2HNDMARAATIDVENUDASDFSDSSCESDSTARSKBIDASDONEZMVSDMIDESSISPPPDGMEMCHRVSQTEMEYDCAWD

2020-10-26
127 min

[VGD-211]RIN - Rin Oga

  • sakura rin censoredbig titssingle workVGDhmjmhajime yanaipornograph tvVGD-211VGD211h-172vgd00211
    • 2020-11-01
    240 min

    [VEC-450]My Mother's Friend Highlights 3 - 4 Hours

  • censoredcreampiemarried womanVECvenusgoddess venusVEC-450VEC450vec00450
    • 2020-11-06
    115 min

    [SSNI-906]I Hate My Lady Boss, But Now I Found Out That She's Working A Side Hustle At A Pink Salon!？ I Made Her Suck The Shit Out Of My Dick And Even Degraded Her By Fucking Her Too. I Turned The Tables On Her In Sex Court!! Miru Sakamichi

  • see the slope censoredblowjobbeautiful girlSSNIs1 no 1 stylezaku araiSSNI-906SSNI906ssni00906
    • 2020-11-07
    114 min

    390JAC-064 [Demon GAL born by Tohoku x 4 vaginal cum shot] Tohoku’s strongest GAL has come to Gyaru Shibe! Tohoku Climax Eagles No. 4 Misser! Saddle tide to fly to Yamazaki Bali! !! Ginji is also astonished at 5 seconds per second! !! Ma-kun als

  • amateur censoredcreampiebig titsjacjac-064jac064390jac-064
    • 2020-11-12
    93 min

    [OKB-099]A Voluptuous Big Ass A Goddess In Bloomers Erica Arimura From A Lolita Beautiful Girl, To A Chubby Girl, We Dressed These Hot Bitches In Tight Bloomers And Gym Shorts So We Could See Their Asses And Cameltoes Bulging Out So Hard Their Pussy

  • eri arimura censoredschoolgirlsingle workOKBdaddy s private photosgoddess in bloomersOKB-099OKB0991okb00099
    • 2020-11-13
    120 min

    [IPIT-009]-- Bad Teacher -- The Hot Blonde Who Fucking Devours Her S*****ts Extreme Temptation!! Emma Lawrence

  • emma lawrence censoredblowjobslutIPITidea pocketzampaaipoke excavation projectIPIT-009IPIT009ipit00009
    • 2020-11-23
    43 min

    FC2PPV 1580866 [Personal shooting] No.023 Kumi-chan & Suzuka-chan ★ Beautiful female college student duo. The breathtaking harem play is exquisite and the best ★ [Complete appearance]

  • amateur uncensoredfc2
    • 2020-11-28
    155 min

    [MMND-192]"Can't Do AV" 99 Cm H-Cup A Quiet Looking Incredibly Slutty And Silent Big Tits Glasses Girl Age 19 Nenne Ui

  • first love censoredbig titssingle workMMNDmimanyuki iwasawaMMND-192MMND192mmnd00192
    • 2020-12-09
    50 min

    [opcyn-125]さら(20)

  • amateur censoredcreampieamateuropcynopcyn-125opcyn125opcyn-125
    • 2020-12-12
    170 min

    [DASD-769]I'll Thank You After I've Cleaned Myself Up... A Married Woman Who Was Waiting For A Miracle, And Seems Like She Ran Away From Home. Aoi Mukai

  • ai mukai censoredslutsingle workDASDdashiromichi hoseDASD-769DASD769dasd00769
    • 2020-12-15
    137 min

    [KUSE-003]Chan Yota (25) Acme X Sexercise

  • chanyota censoredsingle workKUSEsod createanzothis actress style is amazingKUSE-003KUSE0031kuse00003
    • 2020-12-22
    45 min

    279UTSU-474 Natsukisan

  • amateur censoredcreampiemarried womanutsuutsu-474utsu474279utsu-474
    • 2020-12-24
    49 min

    230OREC-661 Urara

  • amateur censoredcreampiebig titsorecorec-661orec661orec-661
    • 2020-12-24
    109 min

    [SPRD-1361]From That Day When I slept Next To My Stepmom... Mio Morishita

  • mio morishita censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1361SPRD136118sprd01361
    • 2020-12-25
    155 min

    [BANK-025]Creampie Sex At An Outdoor Hot Spring - Sweaty Outdoor Fucks! Wild, Cheerful, Busty Babe Who Loves To Get Naughty

  • censoredcreampiebig titsBANKpussy banktake chanBANK-025BANK025h-1495bank00025
    • 2020-12-27
    74 min

    [ETQR-179](Daydream POV) Sex In Her School Uniform - Banging My S*****t Right Before Her Graduation Tsumugi Narita

  • censoredcreampiebig titsETQRerotic timeETQR-179ETQR179h-1186etqr00179
    • 2021-01-07
    50 min

    1Pondo 010721_001 Horny kimono beauty: Nanako Asahina

  • amateur uncensored1pondo
    • 2021-01-12
    86 min

    [LOOTA-030]Lolita - Mitsuki Nagisa

  • mitsuki nagisa censoredLOOTAsupa kubijonLOOTA-030LOOTA030
    • 2021-01-22
    153 min

    [PXH-019]This Girl Answered Our Ad # 003 # Sa-chan (20 Years Old) # From Miyazaki # Divine I-Cup Titties # She Loves To Be Spanked # A Colossal Tits Freelancer # She Cums When Choked # An Explosively Prematurely Cumming Babe

  • censoredcreampiebig titsPXHprestigeprestige hmjmPXH-019PXH019118pxh00019
    • 2021-01-29
    120 min

    [NEM-052]Stepmom's Ass Pull Out In Full View: Family Fun 1 Chisato Shoda

  • shota chisato censoredcreampiebig titsNEMglobal media entertainmentkikujiro akabanenewmomNEM-052NEM052143nem00052
    • 2021-01-31
    119 min

    [BAB-024](Recruited Through Deceit) The Cutest, Youngest Girl We've Had.

  • censoredsquirtingamateurBABbabylon daydreamersBAB-024BAB024bab00024
    • 2021-02-05
    142 min

    [HODV-21546]"I Know You're About To Cum, But I'm Not Going To Stop What I'm Doing, Okay？" Follow-Up Whispering Dirty Talk Pull Out Sexual Teasing That Will Get You To Ejaculate Over And Over Again Tsubasa Hachino

  • yano tsubasa censoredslutsingle workHODVh m pk c takedaHODV-21546HODV215465642hodv21546
    • 2021-02-06
    230 min

    [HUNTA-941]Dangerous Temptation - My Boss's (Teen) Daughter Is Trying To Seduce Me.

  • censoredcreampieschoolgirlHUNTAhunterkawajirihhh groupHUNTA-941HUNTA941hunta00941
    • 2021-02-07
    139 min

    [PKPD-129]Compensation Creampie Dating, Age 18, Colossal Tits, Cheerful Cumming Slut Hana Himesaki

  • himesaki hana censoredcreampiebig titsPKPDfuck group and fun friends daydreamersPKPD-129PKPD129pkpd00129
    • 2021-02-12
    117 min

    [MIAA-392]Seduced By Ultra-Thin Competitive Swimsuits - 3 Nights, 4 Days Of Big Tit Temptation At A Training Camp Hana Himesaki

  • himesaki hana censoredbig titssingle workMIAAmoodyzhiroaeveryone s porn starMIAA-392MIAA392miaa00392
    • 2021-02-20
    120 min

    [C-2617]Girl Trip 018

  • censoredlesbianCgogoscore gogo sC-2617C2617
    • 2021-02-27
    240 min

    [GONE-030]5 Titty-Baring Amateur Girls And Of Course, We Always Love Titties. Girls With Lolita Faces And Big Tits Amateur Titty-Baring Highlights

  • censoredcreampiebig titsGONEmercurysmuGONE-030GONE030h-1133gone00030
    • 2021-03-12
    71 min

    326URF-057 [Back customs] [Furious 4 consecutive shots] [G milk & Kamijiri’s Echiechi ultimate evolution BODY] The ejaculation tech that swings all the ability values erotically is amazing! Ejaculation in the mouth, handjob, facial cumshots,

  • amateur censoredcreampieamateururfurf-057urf057326urf-057
    • 2021-03-13
    171 min

    [JUFE-269]This Voluptuous Slut Will Look Down Upon You With Absolute Contempt As She Exercises Dirty Talk Control Over you The Ultimate POV JOI Video As She Controls Your Ejaculations Chitose Yuki

  • chitose in the evening censoredbig titssingle workJUFEfitchaida yumenoJUFE-269JUFE269jufe00269
    • 2021-03-24
    114 min

    241GAREA-506 Sana

  • amateur censoredbig titsamateurgareagarea-506garea506241garea-506
    • 2021-04-13
    48 min

    H4610 ki210413 Shion Iwaki 21years old

  • amateur uncensoredh4610
    • 2021-04-17
    238 min

    [NPJB-055]They Get Wet After A Little Liquor - Drenched Pussies, Smiling Faces, Tipsy Sex - 4 Happy Hours

  • censoredbig titsbeautiful girlNPJBnanpa japanNPJB-055NPJB055npjb00055
    • 2021-04-24
    99 min

    [BHUST-003]Tokyo Bay Area Only! Nympho Celebrity Sex Circle Lovey Dovey Raw Sex Version!

  • censoredcreampiebig titsBHUSTbig mocalbooker tBHUST-003BHUST00357bhust00003
    • 2021-05-01
    151 min

    [JUL-558]She Looks Like A Star. Gorgeous I-Cup Entrepreneur Uno Kanaya, Age 32, Makes Her Porn Debut!

  • kanaya uno censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-558JUL558jul00558
    • 2021-05-08
    243 min

    [UMSO-391]Secret Affair With Middle Aged Men POV Footage Of 10 Married Women Enjoying Fucking Around vol. 02

  • riho fujimori saori yagami censoredmarried womanmature womanUMSOkm produceumanamiUMSO-391UMSO391umso00391
    • 2021-06-03
    95 min

    [KAAD-054]Our Lovely Mother-In-Law Naomi Arimori

  • naomi arimori censoredcreampiemarried womanKAADcenter villageshibuyahanazono center villageKAAD-054KAAD054h-086kaad00054
    • 2021-06-16
    190 min

    [HUNBL-049]Shut-In Brother Who Used To Monitor His Younger Step Sister Out Of A Twisted Sense Of Love Sees Her For The First Time In Years And...

  • censoredcreampieschoolgirlHUNBLhuntergeminihhh groupHUNBL-049HUNBL049hunbl00049
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-25
    30 min

    359TYVM-167 Saliva Exchange With Tongue Tangled Rich Berokisu Creampie Sexual Intercourse! !!

  • amateur censoredcreampiemarried womantyvmtyvm-167tyvm167359tyvm-167
    • 2021-07-02
    83 min

    483SGK-031 [Unprecedented Ikippa] [Eros bare IT company OL] [Gakuburu endless cum] [Iku if inserted! Transcendental sensitive constitution] [Eloy woman who makes a man stubborn] I was waiting for such a woman! If you insert it, it’s cool! Iku wi

  • itol censoredamateursgksgk-031sgk031483sgk-031
    • 2021-07-10
    124 min

    [MOPT-009]Submissive Men Are Made To Be Tied Up. Slut Turned On By Bondage. Mary Tachibana

  • tachibana mary censoredanalslutMOPTm o paradisemo tightMOPT-009MOPT009mopt00009
    • 2021-07-13
    79 min

    300NTK-606 [Pleasure> A brilliant minimum busty beautiful girl! !! ] It should be a swimsuit photo session …! !! In the open-air bath with the urgent declaration of Saddle! !! In the shower room! !! Of course, it shines in bed and succeeds in

  • amateur censoredcreampiesquirtingntkntk-606ntk606300ntk-606
    • 2021-07-22
    76 min

    FC2PPV 1935700 * Price Will Be Raised On 7/26 1980pt → 3980pt [Appearance] [Uncensored] 3P Gonzo! A 25-Year-Old Office Lady Who Works At A Trading Company Is Super Beautiful, Has Beautiful Breasts, Smooth Skin, And Thin Hair Is Too Erotic! Blow And H

  • amateur uncensoredfc2
    • 2021-08-28
    144 min

    [BDST-458]My Stepsister Is My First Love... Barely Legal Defiled By The Acts Of Detestable Men. Pure-hearted Sex With A Girl On The Brink Of Tragedy... Riona Minami

  • rina minami censoredbeautiful girldramaBDSTbig mocalyumejiBDST-458BDST45857bdst00458
    • 2021-09-04
    227 min

    [YMDD-241]Sex Vlogger"s Videos Blow Up And Gets Secretly Filmed Vlogger Queen

  • censoredblowjobslutYMDDmomotarou eizou shuppandukejaku momoYMDD-241YMDD241ymdd00241
    • 2021-09-04
    55 min

    Caribbeancom 090421-001 Adult Kindergarten: A Student Has Sex With Big Tit Teacher Honoka Orihara

  • honoka orihara uncensoredhandjobcaribbeancom
    • 2021-09-18
    150 min

    [FCDC-135]Slutty Secretary Seduces Employees With Big Butt And Tits Airi Takasaka

  • airi takasaka censoredslutsingle workFCDCweekenderFCDC-135FCDC135fcdc00135
    • 2021-09-27
    89 min

    300MIUM-755 [This Married Woman Is The Most Dangerous! ] A Hardcore "De Metamorphosis!" That Has Been Staring At The Crotch Of Boys Since Elementary School. !! !! 』 De M Wife Who Loves Painful Irama Anyway! !! [Excessive Blowjob Desire] Immed

  • amateur censoredcreampiebig titsmiummium-755mium755300mium-755
    • 2021-10-01
    95 min

    529STCV-022 Riho (18) (Natsu Sano)

  • amateur censoredcreampiesquirtingstcvstcv-022stcv022529stcv-022
    • 2021-10-12
    61 min

    SIRO-4662 [First Shot] [Baby Face X Huge Breasts] [Titty Fuck Service] A Jd With Huge Breasts Who Works At A Maid Cafe Has Appeared. A Baby-Faced, Anime-Voiced Girl Shakes Her Huge Breasts Like Her Pendulum, Spinning Shy But Nasty Words. AV Applicati

  • amateur censoredbig titsamateursirosiro-4662siro4662siro-4662
    • 2021-10-28
    110 min

    [AARM-028]The Thighs of a Married Woman. Rubbing Thighs That Feel So Good

  • alice toyonaka miu susaki censoredmature womanAARMaroma kikakukadowaki shigeoaromaAARM-028AARM028aarm00028
    • 2021-11-04
    47 min

    [110421-001][VR] Amazing posture insertion technique

  • amateur uncensoredcreampiecaribbeancom
    • 2021-11-06
    103 min

    355OPCYN-192 Miona (Miona Kotoha)

  • amateur censoredcreampieamateuropcynopcyn-192opcyn192355opcyn-192
    • 2021-11-06
    128 min

    [CEMD-079]Perfectly Sensitive! 4 Lesbians With Tiny Tits! Hikaru Minazuki, Kurumi Suzuka, Karen Kyowa, Shizuka Hanai. These Girls Get Their Perfectly Sensitive Little Tits Together For Hot Teasing!

  • hikaru minazuki suzuka walnut censoredlesbianmature womanCEMDserebu no tomoCEMD-079CEMD079cemd00079
    • 2021-11-06
    109 min

    [APNS-263]Shameful Home Visit - Hono Konomi

  • yoshimi hono censoredcreampiesingle workAPNSaurora project annexnasu yukihiroAPNS-263APNS263apns00263
    • 2021-11-11
    121 min

    [GUN-759]I Want to Lick the Soles of the Feet of Beautiful Girls Until Their Feet Get Wrinkled! DX

  • akari shinmura rei hanamiya censoredslutbukkakeGUNradixmg yukkybatsugunGUN-759GUN759433gun00759



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi