gold




FC2HMNNACRMILKVENUSDABCAWDAVSAGMEMMEYDMVSDFSDSSMIDEKBIDASDSSNIHDKADTTAUKSHUNTBKSBJ

2020-12-11
155 min

[YMDD-215]I Got My Hands On A Lucky Creampie Ticket, And Now I'm Going To See My Favorite Girl Rika Tsubaki

  • tsubaki rika censoredcreampiebig titsYMDDmomotaro eizotommy boywakamomoYMDD-215YMDD215ymdd00215
    • 2020-12-16
    130 min

    [MXGS-1162]Real Life College Girl 19-Year-Old Meru Amakawa's Porn Debut

  • tianhe censoredbeautiful girlsingle workMXGSmaxingMXGS-1162MXGS1162h-068mxgs01162
    • 2020-12-20
    160 min

    [NNPJ-423]I Seduced Her But Didn't Fuck Her That Day. But Later, I Met Her Again And Creampie Fucked The Shit Out Of Her. She's A Girl With Communication Issues Suzuka-chan 19 Years Old

  • censoredanalcreampieNNPJnanpa japanNNPJ-423NNPJ423nnpj00423
    • 2020-12-25
    126 min

    [BANK-024]Today I Had The Best Sex Of My Life So Far 2 - Yuri Sakura

  • cherry blossom censoredcreampiebig titsBANKpussy banktake chanBANK-024BANK024h-1495bank00024
    • 2020-12-25
    242 min

    [MKMP-371]Iori Nanase Complete BEST 4 Hours

  • iori nanase censoredcreampiebig titsMKMPk m producemillionMKMP-371MKMP37184mkmp00371
    • 2021-01-06
    54 min

    FC2PPV 1634531 [First shot] Kawaiko-chan with prequette and beautiful breasts made me feel good with an oversized cock ❤️❤️

  • amateur uncensoredfc2
    • 2021-01-07
    80 min

    [GRMR-029]素人男子のちんログ。Vol.2 リアル童貞のハジメくん（20）

  • censoredGRMRmura chblood clam abaloneGRMR-029GRMR029h-1534grmr00029
    • 2021-01-08
    180 min

    [ABW-043]Nothing But Raw Fucks, Endless Creampie Sex. Pumped Full Of Cum - 18 Loads, Remu Suzumori

  • suzumori remu censoredcreampiebig titsABWprestigeshimikkiabsolutely wonderfulABW-043ABW043118abw00043
    • 2021-01-17
    120 min

    [BKD-255]Family Fun [Nasu Kengamine Road] Miwa Kagei

  • miwa kagei censoredmature womansingle workBKDrubykoji tsujitobijiBKD-255BKD255bkd00255
    • 2021-01-30
    68 min

    326KNTR-002 [Cuckold Immediately NN Bulletin] A metamorphosis gal who is jealous and estrus cums many times with an actor Ji Po ☆ I am crazy with an unfaithful act begging for pregnancy juice! !!

  • amateur censoredcreampieamateurkntrkntr-002kntr002326kntr-002
    • 2021-02-13
    116 min

    [AVSA-155]A Female Director With Big Tits Wearing Pantyhose Who Falls Into Masochism

  • censoredbig titsAVSAavs collector skaoru suzakuavscollector sAVSA-155AVSA155avsa00155
    • 2021-02-23
    72 min

    451HHH-018 [QUEEN of Butt] [Real Married Woman] [Immediately Wet Guchogucho Glittering Ma ● Ko] A hybrid slut actress with a body of M and a heart of S participates in AV to fill sexlessness with her husband. Frustration Ma ● Ko is Reason Collapse wi

  • amateur censoredcreampiemarried womanhhhhhh-018hhh018451hhh-018
    • 2021-02-25
    121 min

    [FSDSS-179]A Fresh Face This 20-Year Old Wants To Fuck 365 Days A Year Her Adult Video Debut Noa Miura

  • miura noai censoredbig titssquirtingFSDSSfalenodragon nishikawafaleno starFSDSS-179FSDSS1791fsdss00179
    • 2021-03-03
    120 min

    [PFES-012]This Beautiful Office Lady Is Up Close And Unguardedly Luring You To Panty Shot Temptation Minami Aizawa

  • minami aizawa censoredslutsingle workPFESidea pocketichigoharasummer panties festivalPFES-012PFES012pfes00012
    • 2021-03-09
    481 min

    [MUCH-124]Hot Steamy Sex With Forty Something Year Old Vixens 10 Women 8 Hours 2 Video Set

  • shinobu igarashi hitomi kanno censoredcreampiebig titsMUCHmothermuchi mutchiMUCH-124MUCH124h-796much00124
    • 2021-03-13
    122 min

    [EYAN-166]When He Shoved His Cock Into Her Pussy, She Began To Cum While Squirting Breast Milk Minami-san Keeps On Wanting More Helpings Of Cock, No Matter How Many Times She Has Cum!! After Being Neglected For So Long, This Breast Milk Squirting H-C

  • censoredbig titsamateurEYANe bodytakuanwives of hanasagariEYAN-166EYAN166eyan00166
    • 2021-03-13
    236 min

    [CEAD-333]Now That I've Thought About It, I Want To Watch! Grinding, Pressurizing Cowgirl Sex, As This Beautiful Woman Pounds Her Pussy Against Your Cock As She Mounts You And Shakes Her Ass With Abandon!

  • mao watanabe yui hatano censoredcreampiemature womanCEADceleb no tomoCEAD-333CEAD333cead00333
    • 2021-03-25
    123 min

    [FSDSS-194]Her Pussy's On Fire With Pleasure - Screams Of Delight At A Naughty Oil Massage Parlor Arina Hashimoto

  • there is hashimoto censoredsingle workFSDSSfalenogoemonfaleno starFSDSS-194FSDSS1941fsdss00194
    • 2021-03-26
    243 min

    [NASH-473]Hot And Steamy Older Woman Soapland World Class Service From A Voluptuous Sexy Forty Something MILF

  • sachiko ono shinobu oshima censoredcreampiebig titsNASHnadeshikoNASH-473NASH473h-067nash00473
    • 2021-03-27
    60 min

    FC2PPV 1743137 * Weekend limited 3980⇒2980pt ★ First shot amateur ☆ Connected with a dangerous baby-faced mini girl! Erina-chan ☆ Erotic beautiful girl who is released from the tension and immersed in the pleasure of vaginal cum shot ♥ [Personal shoo

  • amateur uncensoredfc2
    • 2021-04-02
    70 min

    328HMDN-350 [Individual / F Cup] Cheating Athlete Wife 47 Years Old And Creampie Affair. Beast sex that shakes hips with a young raw meat stick to devour

  • amateur censoredcreampiemarried womanhmdnhmdn-350hmdn350328hmdn-350
    • 2021-04-07
    28 min

    FC2PPV 1758624 [First shot / sold out] Former local idol self-activity fund, 2 cum swallows BJJ indies ＃ 10

  • amateur uncensoredfc2
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-02
    100 min

    [VENX-033]Step Mother And Step Son Start Fucking 2 Seconds After Step Father Leaves The House Sakura Tsukishima

  • tsukishima sakura censoredcreampiebig titsVENXvenussarufakecest winntersVENX-033VENX033venx00033
    • 2021-06-10
    65 min

    FC2PPV 1861191 [Complete amateur 110] Con 19 years old, complete appearance, duck mouth cute lady style S class beautiful girl tied up in plain clothes H

  • amateur uncensoredfc2
    • 2021-06-12
    120 min

    [MDTM-730]Having Sex In Exchange For Money With My Super Sexy S*****t While She's Ovulating To Get Her Pregnant Rin Miyazaki

  • miyazaki rin censoredcreampieblowjobMDTMuchu kikakutodoMDTM-730MDTM730mdtm00730
    • 2021-06-16
    126 min

    FC2PPV 1870280 Former child actor * Limited quantity * Early purchase recommended *

  • amateur uncensoredfc2
    • 2021-07-01
    120 min

    [DKWT-014]Picking Up Someone Else's Wife I Just Wanted A Part Time Job Washing Dicks...But Got So Horny For Big Hard Dicks That I Even Had Raw Sex 1

  • censoredcreampieamateurDKWToffice k swakadzumaDKWT-014DKWT01436dkwt00014
    • 2021-07-02
    203 min

    [BBAN-333]Who Is She...？ A Barely Legal Suddenly Targeted And Fucked - Aoi Nakajo, Mio Ichijo

  • nakagusuku ichijo mio censoredlesbianBBANbibianBBAN-333BBAN333bban00333
    • 2021-07-16
    133 min

    [BNST-032]She'll Do Anything I Ask: My Convenient Girl!!

  • censoredblowjobBNSTteacher delusion groupsamuraiBNST-032BNST032bnst00032
    • 2021-07-30
    111 min

    [ADN-335]A Story Of Having Chaotic Sex With That Reserved Girl Who Works For A Municipal Office. Nanami Kawakami

  • kawakami nanami censoredsingle workdramaADNattackerssada oka sadaootona no dramaADN-335ADN335adn00335
    • 2021-09-01
    55 min

    FC2PPV 2117805 In Translation [Individual Shooting] "I Don’t Have Menstruation" I Called Twice As A Substitute For My Parents’ Debt. Bristle Pussy Selfish Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-09-17
    97 min

    529STCV-015 Hana

  • amateur censoredcreampiesquirtingstcvstcv-015stcv015529stcv-015
    • 2021-09-17
    118 min

    [MEYD-703]My Father-in-Law Gave Me A Quick Creampie While My Husband Went Out For A 5-minute Smoke Break. Ejaculating 10x Each Day For A Pregnancy. Hotaru Nogi

  • nogi firefly censoredcreampiebig titsMEYDtameike goromishima rokusaburoMEYD-703MEYD703meyd00703
    • 2021-09-24
    63 min

    Caribbeancom 092421-001 The Luxury Adult Spa: Tall Beauty Hospitalizes With Splash And Sex Runa Hinata

  • runa hinata uncensoredcreampiecaribbeancom
    • 2021-10-08
    60 min

    476MLA-054 An Elegant Piano Instructor Leaks Sheets Wet And Leaks Sex! !! Outbursts On The Slender Girls Who Are Accustomed To Papa Katsu! Unauthorized Vaginal Cum Shot 2 Barrage! !! (Minami Saito)

  • amateur censoredcreampieamateurmlamla-054mla054476mla-054
    • 2021-10-14
    62 min

    SIRO-4663 [First Shot] [F Milk With Outstanding Elasticity] [Nasty Look] An F Cup Amateur Who Immediately Blames The Chestnut And Vagina At The Same Time Appears. A Splendid Mature Naked Body, Which Had Been Exhausted For A Long Time, Regains Her Lew

  • amateur censoredbig titsamateursirosiro-4663siro4663siro-4663
    • 2021-10-14
    21 min

    HEYZO 2633 Konoha’s Amazing Footjob – Konoha Kasukabe

  • amateur uncensoredblowjobheyzo
    • 2021-10-19
    59 min

    HEYZO 2636 I Can’t Hold It! Fuck With Friend’s Hot Sexy Mom – Miki Hoshino

  • miki hoshino uncensoredcreampieheyzo
    • 2021-10-21
    93 min

    [OKS-122]Erina Oka: Wet And Shiny, A Perfect Fit For A Godly Swimsuit! Enjoy These Cute Girls In Swimsuits! This AV Starts With A Voyeur Scene Of Big And Small Breasted Girls Changing Clothes And Turns To Close-up Fetishes Including Shaved Pussy, Sid

  • hill erina censoredschoolgirlbeautiful girlOKSoyaji no kosatsukami sukumizuOKS-122OKS1221oks00122
    • 2021-10-22
    116 min

    [SSIS-216]She"ll Open Her Legs Whenever I Tell Her To. J Cups Freeuse Pussy Lover. Mei Washio

  • mei washio censoredbig titssingle workSSISs1 no 1 stylehasami kukaSSIS-216SSIS216ssis00216
    • 2021-11-11
    195 min

    [PIYO-129]Cute Angel Girl Likes Me Too Much, Licking Temptation, Then I Gave Her A Creampie

  • lara kudo white peach censoredcreampieschoolgirlPIYOhiyokopiero tabitchiPIYO-129PIYO1291piyo00129
    • 2021-11-16
    59 min

    SIRO-4669 [First Shot] [Elegant Appearance] [Sigh That Leaks Indecently] Politeness ○ A Beautiful Tutor Who Has Both Wisdom And Bewitching Advent. The Intense Piston From Her Back Writhes Her Outstanding Style, And While She Has An Ecstatic Expressio

  • amateur censoredamateursirosiro-4669siro4669siro-4669
    • 2021-11-16
    483 min

    [KTRA-348]Small Tits Slender Younger-Sister Type 10 Girls Fucked One After The Other 8 Hours 2 Discs

  • yui nagase scooping censoredcreampieKTRAk tribeKTRA-348KTRA348h-094ktra00348
    • 2021-11-17
    74 min

    534IND-011 White Gal Best Beauty / Facial Cumshot / Creampie 2 Shots, Wet Man Geki Pis Video Leaked With Insanely Guarantee * Masturbation Too Much Warning * (Hakuto Wana)

  • amateur censoredcreampieamateurindind-011ind011534ind-011
    • 2021-11-27
    100 min

    [SHM-041]リアルパパ活女子【緊張してる未成年ボディ】ひかりちゃん 18才専門学生 希望光

  • hope light censoredbeautiful girlsingle workSHMsharksledge hammerSHM-041SHM041h-687shm00041
    • 2021-12-03
    118 min

    [RBK-030]The Old Guy My Mom Remarried Ravages Me Every Day. Mako Iga

  • iga mako censoredsingle workdramaRBKattackerskitorune kawaguchiryuu bakuRBK-030RBK030rbk00030
    • 2021-12-04
    140 min

    [PKPD-174]An Easy Job Where All You Have To Do Is Get Creampied - Rino Yuki

  • yuki rino censoredcreampiebig titsPKPDfuck group and fun friends daydreamersPKPD-174PKPD174pkpd00174
    • 2021-12-05
    62 min

    FC2PPV 2487791 Until 12 2480 [No] A Beautiful Hostess. She Commits A Fair And Slender Body With Multiple People And Vaginal Cum Shot Without Permission.

  • amateur uncensoredfc2
    • 2021-12-08
    53 min

    FC2PPV 2498613 [Personal Shooting / Set Sale] Full Version Of Erotic Body Slut Wife As Usual

  • amateur uncensoredfc2
    • 2021-12-25
    65 min

    383MONA-003 Metropolitan Ordinary Course K3 Nagi-Chan (1 ●) Outflow Of Appearance (Nagi Mamiya)

  • amateur censoredcreampieamateurmonamona-003mona003383mona-003
    • 2022-01-07
    118 min

    [DASD-958][Against her Better Judgment] Aphrodisiacs from her Loathed Ex-Boyfriend Lead to Her Body Quaking in Pleasure and Her Skin Covered with Cum. Wild Sex Full of Ecstasy. Yu Shinoda

  • shinoda yu censoredcreampiebig titsDASDdasrokusaburo mishimaDASD-958DASD958dasd00958
    • 2022-01-08
    133 min

    [DVAJ-553]I"m Almost Positive That My Wife Is Committing Infidelity, But She Isn"t Letting It Slip, And It"s Driving Me Insane In This Newly Wed Lifestyle Riho Fujimori

  • riho fujimori censoredcreampiebig titsDVAJalice japankirinDVAJ-553DVAJ553dvaj00553
    • 2022-01-21
    176 min

    [CJOD-329]I"m A Homeroom Teacher Who Was Fucked By Three S*****ts At A Love Hotel After School, Surrounded By Them, Pinched, And Made To Do A Creampie. Aoi Kururugi Yuri Fukada Yuna Himekawa

  • aoi kururugi yuri fukada censoredcreampieschoolgirlCJODchijo heavensapporo taroCJOD-329CJOD329cjod00329
    • 2022-01-31
    51 min

    292MY-540 Mami Sugimura 2

  • amateur censoredmarried womanamateurmymy-540my540292my-540
    • 2022-02-03
    113 min

    [MILK-134]A Beautiful Woman Working At A Lewd Herb Store Is A Horny Cock Addict! As Soon As She Lights Up And Smokes She"s Ready To Drain Those Balls Completely As She Devours That Cock. Sarina Momonaga

  • sarina momonaga censoredcreampieslutMILKmilkMILK-134MILK134h-1240milk00134



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi