high 083




FC2VENUDTTNACXNATRJULAUKGSHKDSDABHMNHZGDMARAHDKABLKMILKSQTEMIAACHRVSTARSATIDCAWD

2020-10-21
115 min

418YSS-10 Murasaki hime

  • amateur censoredbig titsamateuryssyss-10yss10418yss-10
    • 2020-10-22
    59 min

    299EWDX-329 Arisa 37 years old Super natural wife [Celebrity wife]

  • amateur censoredbig titsmarried womanewdxewdx-329ewdx329299ewdx-329
    • 2020-10-30
    83 min

    [MBRAQ-022]処女のキモチ 世良純

  • masumi sera censoredMBRAQsidspice visualMBRAQ-022MBRAQ022h-816mbraq00022
    • 2020-11-06
    138 min

    [HODV-21524]Seduced By My Girlfriend's Bestie... She Captured Me With Her Squirting Pussy... Reika Hashimoto

  • reika hashimoto censoredcreampieslutHODVh m pHODV-21524HODV215245642hodv21524
    • 2020-12-10
    45 min

    FC2PPV 1601490 [Almost appearing] A slender body nympho married woman, a high-speed self-piston straddling the cock so that the generalized erogenous zone w sticks after drinking Ai ○. De transformation married woman w who rolls up

  • amateur uncensoredfc2
    • 2020-12-20
    240 min

    [REXD-347]Health Checkup By Savage Doctor: Housewives Fucked After Being Administered Their Medicine "I... Sle... What？"

  • censoredcreampiemarried womanREXDredgroupREXD-347REXD347rexd00347
    • 2020-12-21
    121 min

    [GENM-066]The Trap That Led To Her Downfall Into Becoming A Cum Bucket Started With The Temptation Of Social Media Non Ayakaze

  • saifu non censoreduniformsingle workGENMgenekigr 3GENM-066GENM066genm00066
    • 2020-12-24
    84 min

    [sdgn-010]ちはるちゃん(21)

  • amateur censoredcreampiebig titssdgnsdgn-010sdgn010sdgn-010
    • 2020-12-27
    103 min

    [HONB-199]Saisho de Saigo

  • censoredamateurHONBmercurythe first shibuya special f e headquarHONB-199HONB199h-1133honb00199
    • 2020-12-31
    119 min

    [JUL-437]A Married Woman Cleaning Lady And A New Employee Are Engaged In A May-December Adultery Affair, Seeped In Lust And Desire. Yuko Shiraki

  • shiraki yuko censoredmature womansingle workJULmadonnamametaro mamezawaJUL-437JUL437jul00437
    • 2021-01-05
    59 min

    200GANA-2407 In the spear room of the Nampa teacher of 100 battles, I was a daughter who broke up without exchanging contact information even if I drank together once at the 186 bar, but I was worried about it and went to the room again It was a big

  • amateur censoredamateurganagana-2407gana2407200gana-2407
    • 2021-01-30
    72 min

    476MLA-020 [Pool Nampa] Mabu cheeky yankee gal is M-ki kitten sudden change! !! I fell in love with Ji ● A devoted blowjob dedicated to Po…. Aim at the G-spot in the back of the vagina with a huge chin that sticks into the minimum body! !! !!

  • amateur censoredamateurbeautiful girlmlamla-020mla020476mla-020
    • 2021-02-06
    20 min

    FC2PPV 1674978 Limited to 3 days [Individual shooting] Prefectural Commercial Department ② Delicate G cup. Snowboard snowboarding first experience + vaginal cum shot by two adults

  • amateur uncensoredfc2
    • 2021-02-18
    172 min

    [SSNI-989]During Her Business Trip, To Her Surprise, She Was Booked Into The Same Hotel Room With Her Asshole Boss (Whom She Hates With A Passion) ... So He Banged Her With Excessive Lust And Relentless Piston-Pounding Thrusts And Kept This Big Tits

  • yua mikami censoredbig titssingle workSSNIs1 no 1 styleamazing meatSSNI-989SSNI989ssni00989
    • 2021-02-19
    131 min

    [BIJN-194]The Document - Instinctive, Orgasmic Sex Caught On Camera - Screaming, Swooning Orgasms, Beautiful BODY - Extreme Climaxes Hazuki Wakamiya

  • wakamiya censoredbig titssquirtingBIJNbijin majo emmanuelleBIJN-194BIJN194bijn00194
    • 2021-02-19
    125 min

    [TIKP-055](Stepbrother/Stepsister) How I Became My Stepbrother's Sex Toy - Video Record Of My Confinement Mahiro Ichiki

  • mahiro ichiki censoredcreampiesingle workTIKPtikitiki.comerTIKP-055TIKP055tikp00055
    • 2021-02-26
    192 min

    [SABA-678]While Committing Adultery Sex, She Received A Call From Her Husband And When She Answered The Call While Fucking, That Sent Her Sensuality To The Max "I Told You Not To Fuck Me When I'm On The Phone, Ahhhhh!!!" And That's Ho

  • censoredbig titsSABAskyu shirotohasshiSABA-678SABA678h-244saba00678
    • 2021-03-10
    52 min

    FC2PPV 1719387 [Personal shooting] ♀ 302LJ series Yu ◯ -chan 18 years old 1st time first shot! A natural G-cup Lori busty girl who is mistaken for J © gets pregnant at the same time as graduating with a dangerous day cum shot! ？？ (LOL)

  • amateur uncensoredfc2
    • 2021-03-12
    146 min

    [SCOP-711]Checking Out A Lead That Says There Are Super Sensitive Slutty Masseuses Rub Oil On Their Bodies While Their Customers Watch And Shake Their Asses!

  • censoredcreampiebig titsSCOPscoopk taromousouzokuSCOP-711SCOP711h-565scop00711
    • 2021-03-13
    87 min

    [VEC-469]My Mother`s Friend Yukino Nagisa

  • yukino nagi censoredcreampiebig titsVECvenuspetermegami venusVEC-469VEC469vec00469
    • 2021-03-30
    67 min

    491TKWA-078 A delicate little girl is tossed by ugly men in uniform cosplay!

  • amateur censoreduniformamateurtkwatkwa-078tkwa078491tkwa-078
    • 2021-04-01
    242 min

    [ZMAR-039]Totally! Sumire Mizukawa

  • mizukawa violet censoredbig titsmature womanZMARplanet plusthe whole damn thingZMAR-039ZMAR039h-237zmar00039
    • 2021-04-09
    146 min

    [MIDE-913]Cumming Just From Rim Jobs! Special Licking Brothel Tsubomi

  • bud censoredblowjobslutMIDEmoodyztequilia tinomoodyz divaMIDE-913MIDE913mide00913
    • 2021-04-13
    207 min

    [STARS-366]Real College Girl And Sometimes SODstar - Mio Mashiro AV DEBUT

  • mio mashiro censoredbeautiful girlsingle workSTARSsod createeasy matsumotosod starSTARS-366STARS3661stars00366
    • 2021-04-15
    132 min

    [NYL-004]Tied Up Big Titted Female President Rui Ayukawa 50 Years Old

  • ayukawa rui censoredbig titsmature womanNYLnile daydream tribeichikan abashiriNYL-004NYL004nyl00004
    • 2021-04-17
    116 min

    [JUL-551]I'm In Trouble! Seduced By The Married Woman Next Door Right Next To My Cruel Wife Jun Harumi

  • jun shunmei censoredmature womansingle workJULmadonnahiroyuki kimuraJUL-551JUL551jul00551
    • 2021-04-20
    86 min

    [VNDS-3365]Stepmom Finds Her Stepson's Porn In His Room And Gets Off To It

  • fumi miyazawa kyoka kahara anka kahara censoredbig titsmature womanVNDSstar paradisenext toilet r eVNDS-3365VNDS3365h-254vnds03365
    • 2021-04-24
    141 min

    [CHCH-005]While My Friend Was Away For Three Days, I Nailed His MILF With Colossal Tits And Filmed It

  • censoredbig titsmature womanCHCHmilk and moms emmanuellemikadzuki hajimemilk and momsCHCH-005CHCH005chch00005
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-13
    103 min

    [SDHS-018]I'm With My Girlfriend Suzu, Who Is Older Than Me ... We Did Everything In Slow Motion On Our Holiday Date Suzu Honjo

  • suzu honjo censoredSDHSsod createinoue japanSDHS-018SDHS0181sdhs00018
    • 2021-06-04
    146 min

    [JUL-607]I Have To Go On A Two Night Three Day Business Trip, Leaving My Submissive Wife With My Lecherous Father... Arisu Nanase

  • alice nanase censoredmature womansingle workJULmadonnamametaro mamezawaJUL-607JUL607jul00607
    • 2021-06-05
    120 min

    [SOAN-059]This MILF Mama Of 2 Will Get Both Her Holes Domesticated Today ... This Seriously Amateur Housewife Is Thinking About Her Husband And How She Can Satisfy His Cuckold Desires, So She's Decided To Star In This Video Sanae Sekikawa (Not He

  • censoredamateurSOANyama to soramaketaro tanizokoanal visitSOAN-059SOAN059soan00059
    • 2021-06-10
    119 min

    [FSDSS-236]I Tried And Tried And Tried To Resist, But Finally I Could No Longer Resist, And I Succumbed To The Lure Of Forbidden Sex With My Girlfriend's Little Sister, And Fucked Her For 2 Days, And Nobody Must Every Know About It. Sora Amakawa

  • tenkawa sora censoredbig titsblowjobFSDSSfalenomanyufaleno starFSDSS-236FSDSS2361fsdss00236
    • 2021-06-14
    82 min

    FC2PPV 1869086 [3480 → Limited number 2480] Newscaster-like 18-year-old ❤️ Intelligent busty beauty who was given two things to heaven ❤️ Secret libido divergence of a major mail order site employee ❤️ Cloudy special mass cum shot with the second coc

  • amateur uncensoredfc2
    • 2021-06-24
    121 min

    [FSDSS-247]A Bubbly Cosplayer Attacks Guys' Nipples - Nori Kawanami

  • real village henan censoredcosplaybeautiful girlFSDSSfalenotake dfaleno starFSDSS-247FSDSS2471fsdss00247
    • 2021-07-22
    72 min

    [inst-141]ここな＆まみ

  • amateur censoredcreampieamateurinstinst-141inst141inst-141
    • 2021-07-31
    69 min

    ION-097 Rio

  • amateur censoredamateurionion-097ion097ion-097
    • 2021-08-26
    122 min

    [FSDSS-272]Big Tit Colleague Fucks Virgin Boy In The Company Dorm Yuko Ono

  • yuko ono censoredbig titsFSDSSfalenomeatfaleno starFSDSS-272FSDSS2721fsdss00272
    • 2021-09-04
    144 min

    [SORA-332]"I Came Without My Bra On So That I Can Become An Exhibitionist At Any Time" This Trade School S*****t With H-Cup Soft Breasts Is Walking Around Town, Looking For Sketchy Situations And Letting Her Erotic Shame Run Wild! She"ll

  • amu ohara censoredbig titsslutSORAyama to sorahimurokkuSORA-332SORA332sora00332
    • 2021-09-07
    129 min

    [KTRA-327]Enticing Sex Every Day With My Younger Stepsister, Who Has A Brother Complex And Is Good At Being Spoiled, Aya Mamiya

  • aya mamiya censoredcreampieuniformKTRAke toraibuk tribeKTRA-327KTRA327h-094ktra00327
    • 2021-09-09
    128 min

    [AARM-014]Thigh Job And Ass Job Over Underwear - Boys Wear Briefs Too, So Contact Area Can Be Seen Well! Part. 5

  • yui nagase mizuki yayoi censoredslutAARMaroma planninghamu oujiaromaAARM-014AARM014aarm00014
    • 2021-09-10
    89 min

    483SGK-041 [Creampie Breaking Through The Limit] [4 Barrage Raw Saddle] [Zutto Ikippa Climax Crazy] [Neck ● Me Favorite Super Masochist] [Tapioca Shop Clerk] Unlimited Endless Climax! Inexhaustible Infinite Libido! Infinite Niagara Squirting! Demon I

  • amateur censoredcreampieamateursgksgk-041sgk041483sgk-041
    • 2021-09-11
    117 min

    [CMF-063]Fallen Lady: Hidden Masochist Servant - Saya Minami

  • minami saya censoredbdsmsingle workCMFcinemagicdirty kudouninfuCMF-063CMF063cmf00063
    • 2021-09-18
    66 min

    H4610 ki210919 Eri Tanba 22years Old

  • amateur uncensoredh4610
    • 2021-09-24
    78 min

    520SSK-028 [Sex Appealing Strongest Beauty Who Seduces Infinitely] Everything From Looks To Voice Is Seduced By A Fascinating Beauty And A Dirty Date For The Rest Of Her Life! !! In The Car On The Move, I’m Stimulating Po, And I’m Going To

  • amateur censoredcreampiebig titssskssk-028ssk028520ssk-028
    • 2021-09-25
    12 min

    FC2PPV 2249703 My Husband Came Home. She Is A Horny Busty Wife Who Is Pleased With Other Sticks. She Pours Another Person’s Juice Into Her Sexless Vagina And Conceives Her Second Child.

  • amateur uncensoredfc2
    • 2021-09-25
    57 min

    Pacopacomama 092521_537 Mature Lady Piledriver Position BJ : Nagisa Shinohara

  • amateur uncensoredpacopacomama
    • 2021-10-07
    88 min

    [REBD-594]Noeru Jumping Fairyland - Noeru Honda

  • honda noeru censoredsingle workREBDrebeccasawamura akiraREBD-594REBD594h-346rebd00594
    • 2021-10-15
    82 min

    259LUXU-1494 Luxury TV 1470 A Beautiful Medical Student Who Is Unfamiliar With Sex From An Environment That Grew Up In A Serious And Overprotected Family Appears On AV! When She Is Gently Caressed By An Inexperienced Body, She Gradually Becomes Encha

  • amateur censoredbig titsamateurluxuluxu-1494luxu1494259luxu-1494
    • 2021-10-18
    66 min

    530DG-019 ＃ 3 Female ○ Student By Convenience Store Manager ●●●● Video

  • amateur censoredcreampiebig titsdgdg-019dg019530dg-019
    • 2021-10-22
    225 min

    [HUNTB-127]I Call A "Rental Step-Mommy" Over To My Dirty Room When I Get Sick. This Popular "Rental Step-Mommy" Nurses Me Back To Health With Her Amazing Big Tits.

  • censoredcreampiebig titsHUNTBhunterkoichi davidsonhhh groupHUNTB-127HUNTB127huntb00127
    • 2021-11-05
    38 min

    FC2PPV 2405470 * Active Model * Leaked * Early Sale Planned * Squirting Destroys The Camera! Creampie In A Perverted Model ♡ * Rare Thing * You Can See Without All Moza In The Review Privilege *

  • amateur uncensoredfc2
    • 2021-11-10
    62 min

    SIRO-4701 [First Shot] [Glossy Sex Appeal] [Continuous Cum At The Woman On Top Posture] A Frustrated Tall Office Lady Who Has A Mature Erotic Body Appears. When A Big Cock Is Inserted Into A Secret Part That Gets Wet And Shines, It Reveals Pleasure W

  • amateur censoredamateursirosiro-4701siro4701siro-4701
    • 2021-11-12
    235 min

    [ACZD-006]Breaking The Anal Upper Limit Yui Misaki

  • yui misaki kansai month ramii censoredanallesbianACZDsanwa shuppanabnormal.companiesACZD-006ACZD006h-019aczd00006
    • 2021-11-20
    64 min

    H0930 ki211121 Madoka Sekiguchi 38years old

  • amateur uncensoredh0930
    • 2021-12-16
    57 min

    H4610 ki211216 Nanako Shirai 20years old

  • amateur uncensoredh4610



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi