high visio amateur big tit javcensored




FC2WAAAFSDSSMILKMVSDAWDATIDMIAAMIDENATRADNIPXPPPDDASDABWNGODLULUKSBJCAWDAPODSDAB

2020-12-07
42 min

[ore-732]ネネ

  • amateur censoredcreampiebig titsoreore-732ore732ore-732
    • 2020-12-08
    140 min

    [MSFH-042]I Teased This Bitch To No End With Pull Out Sex So I Started High-Speed Piston-Pounding That Twat Until Her Pussy Was Overflowing With Massive Amounts Of White And Foamy Cunt Juice Ami Kitai

  • kiyo ami censoredbig titssingle workMSFHsod createdragon nishikawams sodMSFH-042MSFH0421msfh00042
    • 2020-12-18
    146 min

    [TSF-010]Unemployed Guy Wakes Up As A Woman (21) - After Exploring Her New Body Thoroughly She Submits To A Self-Proclaimed Pussy Whisperer - Getting Tied Up Awakens Her Inner Slut Morito Fukuda

  • morito fukuda censoredslutTSFprincess kaguya pt delusional familywife s trapfeminization reportTSF-010TSF010tsf00010
    • 2020-12-20
    158 min

    [MISM-191]Consultant Trainee Gets Her Asshole Stretched Wide Open Too Much So That It Won't Close

  • censoredanalMISMm girls labinaballMISM-191MISM191mism00191
    • 2020-12-23
    91 min

    [SDHS-017]Horny Sluts Satisfy Themselves With The Creampie Dildo Of Their Dreams

  • iori furukawa masami ichikawa censoredbeautiful girlSDHSsod createSDHS-017SDHS0171sdhs00017
    • 2020-12-24
    93 min

    [OKP-074]Goddess Office Lady In Glasses - Sara Yurikawa - Enjoy Her Beautiful Legs Wrapped Up In Pantyhose, Including Her Toes And The Soles Of Her Feet! - Experience Face-Sitting, Footjobs, Assjobs, And Bukkake Fucking! - Perversion Training Has Her

  • yurigawa sara censoredsingle workbukkakeOKPdaddy s private photosgoro koenjigodly pantyhoseOKP-074OKP0741okp00074
    • 2021-01-08
    131 min

    [DTT-072]A Married Woman Life Insurance Sales Lady Who Will Accept Any Sexual Demand From Her Customer In Order To Make A Sale Megu Sugizaki 31 Years Old Her Adult Video Debut She's Got Light Skin And A Voluptuous Body And She'll Lure You To

  • meg sugisaki censoredbig titsmature womanDTTprestigeitoman akifumikanbiDTT-072DTT072118dtt00072
    • 2021-01-08
    208 min

    [NHDTB-481]She Sneaks My Cock Inside While Giving Me A Massage Next To My Wife Cowgirl Creampies With An Esthetician 3

  • censoredslutNHDTBnatural highkansukeNHDTB-481NHDTB4811nhdtb00481
    • 2021-01-20
    119 min

    [SPZ-1092]Cash For Pics - Beautiful Honor S*****t Is A Secret Slut With Blossoming Tits

  • censoredschoolgirlbeautiful girlSPZstar paradisestar paradiesSPZ-1092SPZ1092h-254spz01092
    • 2021-01-25
    58 min

    FC2PPV 1658362 January only [Uncensored] Supporting local hard-working students. Coming-of-age photography in the city. Continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-01-29
    44 min

    [fan-097]あいる

  • amateur censoredbig titsamateurfanfan-097fan097fan-097
    • 2021-02-03
    52 min

    FC2PPV 1670637 [Personal shooting] SS-class beauty Rika-chan (22 years old)’s first shot in her life! Gonzo copulation excited about the appearance of a super cute amateur panting

  • amateur uncensoredfc2
    • 2021-02-13
    133 min

    [CESD-976]Slut Gets Horny And Wets Herself When She Puts Glasses On - Momo Kato ka

  • kato momoka censoredsquirtingmature womanCESDceleb no tomoCESD-976CESD976cesd00976
    • 2021-02-13
    245 min

    [KDMI-032]Fucking Queen Amazing

  • maria nagai yuki god censoredcreampieKDMImiludopamixKDMI-032KDMI032kdmi00032
    • 2021-02-16
    131 min

    FC2PPV 1688712 Immediate purchase is advantageous ★ Genuine J 〇 Geki Kawarori big breasts ★ Honpo first public release ★ All the techniques to persuade from encounters are released at once ★ A total of 150 minutes or more blockbuster ★ Raw Saddle lim

  • amateur uncensoredfc2
    • 2021-02-22
    98 min

    [QRDF-008]SM Queen Road VOL.43 - Yuria

  • censoredanalQRDFqueen roadQRDF-008QRDF008qrdf00008
    • 2021-02-25
    122 min

    [IESP-677]Mao Watanabe S********l Takes 20 Creampie Loads In A Row

  • mao watanabe censoredcreampiebig titsIESPienergykikuriniespIESP-677IESP6771iesp00677
    • 2021-03-02
    62 min

    300NTK-528 [Superb H busty beauty] 3 shots to a beautiful man of squeezing! !! With semen! !! With love juice! !! The rich SEX of a horny beauty is dueroi! !! That’s right! !! An intense piston that feels swaying! !! Equipped with a constricted

  • amateur censoredcreampiebig titsntkntk-528ntk528300ntk-528
    • 2021-03-18
    50 min

    H0930 ki210318 Kozue Soma 42years old

  • amateur uncensoredh0930
    • 2021-03-19
    143 min

    [TIKP-056]A Perverted Dirty Old Man's Fuck Videos A-tan

  • censoredcreampieschoolgirlTIKPtikitiki.comerTIKP-056TIKP056tikp00056
    • 2021-03-19
    46 min

    [jpak-002]ゆう

  • amateur censoredcreampieuniformjpakjpak-002jpak002jpak-002
    • 2021-03-27
    50 min

    Pacopacomama 032721_452 Maternity Immoral SEX Nanako Asahina

  • amateur uncensoredpacopacomama
    • 2021-04-02
    70 min

    328HMDN-350 [Individual / F Cup] Cheating Athlete Wife 47 Years Old And Creampie Affair. Beast sex that shakes hips with a young raw meat stick to devour

  • amateur censoredcreampiemarried womanhmdnhmdn-350hmdn350328hmdn-350
    • 2021-04-02
    190 min

    [NKKD-203]These Couples Missed The Last Train So They Spend The Night Together! - They Just Happened To Be Going In The Same Direction, But They End Up Sharing More Than Just A Taxi! 10

  • censoredbig titsbeautiful girlNKKDjet eizomanji groupNKKD-203NKKD203nkkd00203
    • 2021-04-03
    41 min

    188HINT-0450 Akane

  • amateur censoredcreampiemarried womanhinthint-0450hint0450188hint-0450
    • 2021-04-22
    24 min

    FC2PPV 1778421 [Personal shooting] Licking a big pie ♡ Maid clothes Tecateka panties mass bukkake!

  • amateur uncensoredfc2
    • 2021-05-04
    55 min

    498DDH-013 [Men’s Esthetic Voyeur] If you get an erection involuntarily on the H cup pie that the big tits practitioner hit on purpose …

  • amateur censoredcreampiebig titsddhddh-013ddh013498ddh-013
    • 2021-05-11
    140 min

    [STARS-372]My Step Son's Morning Wood Nympho Step Mother Sucks And Slurps On His Hard Rod

  • suzu honjo censoredsingle workdramaSTARSsod createosamushi sugawarasod starSTARS-372STARS3721stars00372
    • 2021-05-19
    121 min

    [GVH-237]Cooped Up At Home 2 Months Until Conception Aoi Mukai

  • ai mukai censoredcreampiesingle workGVHglory questhajime kimuraGVH-237GVH23713gvh00237
    • 2021-05-22
    121 min

    [RYZR-004]Mouth-Watering Half Japanese Girl With A Huge Ass And Huge Tits 2 Yuki

  • censoredcreampiebig titsRYZRtoyohikotoyohikotoyohiko kikakuRYZR-004RYZR004ryzr00004
    • 2021-05-28
    155 min

    [BANK-039]Raw Sex Outdoor Hot Spring Beautiful Big Titty Slut With A Pretty Face Girl With Hard Nipples Who Loves Sex

  • censoredanalcreampieBANKpussy banktake chanBANK-039BANK039h-1495bank00039
    • 2021-06-04
    219 min

    [HUNTB-025]"Did You Get Hard？ If You Ask Me Nicely, I'll Let You Stick It In Just This Once..." Your Busty Older Stepsister Hasn't Gotten Laid In Three Years And She's So Frustrated That She's Ready To Take Your Creampie!

  • censoredcreampiebig titsHUNTBhunterkoichi davidsonhhh groupHUNTB-025HUNTB025huntb00025
    • 2021-06-04
    120 min

    [SSIS-082]Whatever I Do, This Maso Maid Will Agree To Whatever It Is, So I Spent 2 Days Fucking Her Brains Out Until I Finally Got Tired Of Fucking Tsubaki Sannomiya

  • sannomiya tsubaki censoredbeautiful girldeepthroatSSISs1 no 1 styleinaballSSIS-082SSIS082ssis00082
    • 2021-06-05
    240 min

    [MLSM-046]S-class Beautiful Mature Woman Best Hibiki Otsuki 4 Hours, Slender Madonna With Beautiful Tits

  • otsuki sound censoredcreampiemarried womanMLSMmellow moonMLSM-046MLSM046mlsm00046
    • 2021-07-08
    72 min

    10musume 070821_01 The Structure Of Woman : Examing a Cutie’s Gorgeous Body Hazuki Doumoto

  • amateur uncensored10musume
    • 2021-07-30
    31 min

    481SACZ-053 Minami 1

  • amateur censoredamateurbdsmsaczsacz-053sacz053481sacz-053
    • 2021-08-08
    69 min

    345SIMM-658 Sperm Drinking System J ○! ？？ "Non", Who Is Cute Like A Small Animal, Is A Natural Active School Girl! For Non-Chan, Who Loves Him So Much That He Gets Out Of School And Comes To See Him, He Works Hard And Makes A Large Amount Of

  • amateur censoredcreampieuniformsimmsimm-658simm658345simm-658
    • 2021-08-10
    131 min

    496SKIV-016 Nazuna-Chan (21) 2

  • amateur censoredcreampieamateurskivskiv-016skiv016496skiv-016
    • 2021-08-13
    120 min

    [SSIS-159]Extreme Orgasming 139 Times! 5120 Spasms! 2100 cc Of Squirt Juice! A Slender 152cm Beautiful Girl"s Eros Awakens. The First Great Spasm Special. Ren Hirose

  • hirose lotus censoredsquirtingbeautiful girlSSISs1 no 1 stylehasami kukaSSIS-159SSIS159ssis00159
    • 2021-09-07
    59 min

    HEYZO 2605 Banging A Horny Girl! Vol.2 – Rino Kudo

  • rino kudo uncensoredcreampiehandjobheyzo
    • 2021-09-27
    129 min

    FC2PPV 2255291 [Tif2019 Appearance A ○ Dollar] ~ Limited Quantity ~

  • amateur uncensoredfc2
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-11-12
    89 min

    529STCV-036 The Flag-Raising With Adult Sex Appeal The Carnivorous Unequaled Female President Appeared! !! The Woman Who Can Work Is Also Top-Notch! Any Man Can Do It With Super-Dreadnought Tongue Technique! A Model-Class Slender Beauty Squirts Indec

  • amateur censoredcreampieamateurstcvstcv-036stcv036529stcv-036
    • 2021-11-25
    117 min

    [SPRD-1488]Surrogate Mother Hana Haruna

  • haruna hana censoredcreampiemature womanSPRDtakara eizosanpei suminekoaleddinSPRD-1488SPRD148818sprd01488
    • 2021-12-09
    122 min

    [IESP-689]Reona Tomiyasu. S********l. 20 Loads In A Row Creampie

  • takehiro tomiyasu censoredcreampieschoolgirlIESPie nergytaiga kosakaiiespIESP-689IESP6891iesp00689
    • 2021-12-10
    169 min

    [SSIS-264]I"ve Always Wanted To Get Jammed By Colossal Tits Like These ... The Man Could Not Resist That Titty Fuck. This Titty Bitch Can Make His C*ck Melt Like Butter Between Her Titties Aka Asuka

  • arisu aka censoredbig titsslutSSISs1 no 1 stylegoemonSSIS-264SSIS264ssis00264
    • 2021-12-17
    92 min

    467SHINKI-070 "Depaga" [Train Molester] [Home Voyeur] [Sleep Fuck] Black Tight Knit Pink P (Of Yuki)

  • amateur censoredcreampieamateurshinkishinki-070shinki070467shinki-070
    • 2021-12-22
    74 min

    259LUXU-1507 Luxury TV 1499 A Slender Older Sister Who Handles Race Queens And Underwear Models Is Here! At First, While Being Nervous, He Gradually Becomes Bold From A Thick Kiss, And In Proportion To That, The Secret Part Is Wet With Love Juice. Th

  • amateur censoredbig titsamateurluxuluxu-1507luxu1507259luxu-1507
    • 2021-12-23
    85 min

    [HIMA-097]My Beloved Stepmom Got Remarried Chisato Shoda

  • shota chisato censoredcreampiemarried womanHIMAcenter villageshibuyahanazono center villageHIMA-097HIMA097h-086hima00097
    • 2021-12-24
    209 min

    [HUNTB-174]"I"ll Keep What Happened Yesterday A Secret ... So Let"s Fuck One More Time, Okay？" When I Woke Up, There She Was, This Big Tits Girl, The One Woman I Should Never Had Laid Hands On (My Best Friend"s Girlfriend, My Sist

  • censoredcreampiebig titsHUNTBhuntercognac kaminohhh groupHUNTB-174HUNTB174huntb00174
    • 2022-01-04
    19 min

    [HEYZO-2695]Hiromi Okura Yu Toyota FFM Blowjob! -Hiromi Okura and Yu Toyota-

  • hiromi okura yu toyota uncensoredhandjobheyzo
    • 2022-01-08
    135 min

    [MOPP-047]The Story Is About A Man Who Is Made To Dress Up As A Girl And Has His Nipples And Anus Fucked. Mao Hamasaki

  • hamazaki mao censoredslutsingle workMOPPm o paradisemo platinumMOPP-047MOPP047mopp00047
    • 2022-01-11
    89 min

    374IMGN-033 Tsukino

  • amateur censoredcreampiebig titsimgnimgn-033imgn033374imgn-033
    • 2022-01-14
    168 min

    [MEYD-735]Debut Of A 26-Year-Old Married Woman Who Lives In Omiya, Saitama Prefecture. Manami

  • censoredMEYDtameike gorotakarase hironoriMEYD-735MEYD735meyd00735
    • 2022-01-15
    110 min

    [SYKH-040]"The Slutty Wife." The Second-Rate Mature Woman, Shizuka. 43 Years Old.

  • censoredcreampieamateurSYKHyuukan mrs emanielSYKH-040SYKH040sykh00040
    • 2022-01-21
    182 min

    [HMN-111]I Had Thought That The Company Subordinate Had The Aspect Of A Cute Younger Sister. She Tried To Tempt Me Into Going Out To Eat With Her. I Spent The Whole Day On A Date With Her, Keeping Her Company And Being Manipulated By Her. After That,

  • white peach censoredcreampieblowjobHMNhon nakabacon tanakaHMN-111HMN111hmn00111



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi