high vision amateur creampie nampa




FC2SPRDMEYDSANBLKMARADTTGMEMONEZLULUFSDSSPPPDHNDMIDVSSISCAWDGVHSHKDCJODNACXAWD

2021-02-01
120 min

[NACR-394]Unfaithful Housewives: A Son's Wife Seduced By Her Father-In-Law Into Shocking Adultery Natsuki Nagahara

  • nagatsuki natsuki censoredcreampieblowjobNACRplanet plusbito sakurananakuruNACR-394NACR394h-237nacr00394
    • 2021-02-06
    121 min

    [SSNI-979]I'm At A Premature Ejaculation Improvement Clinic, But For Some Reason I'm Receiving Relentlessly Teasing Soapland Plays, And It's Giving Me A Serious Hard On... I Eventually Lost Control And Had Myself A Free-For-All Fuck Fest

  • miharu hanasaki censoredbig titsblowjobSSNIs1 no 1 stylemichiru arashiyamaSSNI-979SSNI979ssni00979
    • 2021-02-18
    80 min

    [ETQR-197](Daydream POV Fantasies) We're Making A Sexual Monster Amateur Available For Rent. A Real-Life College Girl Nozomi-chan 20 Years Old

  • censoredcreampieblowjobETQRerotic timeETQR-197ETQR197h-1186etqr00197
    • 2021-02-20
    55 min

    Caribbeancom 022021-001 Soapland With Young Girl Only, 10 Minori Koike

  • minori koike uncensoredcreampiehandjobcaribbeancom
    • 2021-02-20
    56 min

    FC2PPV 1671744 [Personal shooting] Raw vaginal cum shot! Nanami 25 years old becomes shaved and re-appears ★ 168 cm amateur girls are too sensitive and scream and scream! Nanami 2.mp4

  • amateur uncensoredfc2
    • 2021-02-25
    61 min

    1Pondo 022521_001 Browjob and SEX in the Futon: Airi Mikumo

  • amateur uncensored1pondo
    • 2021-02-27
    120 min

    [MIRD-210]My Colleagues From My Part-Time Job Missed Their Last Train Home, So Now They're Spending The Night At My Place!! They're Unleashing Their Full Erotic Powers And Wiggling And Jiggling Those 4 Big Divine Titties Until The Break Of Da

  • tsubaki rika nene tanaka censoredbig titsslutMIRDmoodyzwild sevenmoodyz realMIRD-210MIRD210mird00210
    • 2021-02-27
    240 min

    [FSPT-009]10 Loads In A Row Creampie: Youthful And Fiery, 10 People, 240 Min.

  • censoredbig titsschoolgirlFSPTfirst starpeachteenFSPT-009FSPT009h-491fspt00009
    • 2021-03-04
    14 min

    FC2PPV 1711206 [Personal shooting / No Yarase / Authentic vaginal cum shot] Uncut authentic vaginal cum shot 1 Unnecessary gal Rin 21 years old

  • amateur uncensoredfc2
    • 2021-03-09
    57 min

    Pacopacomama 030921_444 My best friend’s sister is a slut!

  • amateur uncensoredpacopacomama
    • 2021-03-11
    132 min

    [GUN-749]Vibrator Masturbation With Super Small Swimsuits

  • aki erie arai erie yuka osawa rumi tadami censoredsquirtingGUNradixshio sakurabaexceptionalGUN-749GUN749433gun00749
    • 2021-03-12
    105 min

    [XRW-985]100kg Weight Difference! Peek Into The Sexy Lifestyle Of A Super Skinny Girl And Fat Buff Man Couple

  • censoredamateurXRWreal worksreal real worksXRW-985XRW985172xrw00985
    • 2021-04-01
    65 min

    413INST-109 [Amateur individual shooting] Height 180 cm Charismatic men’s women’s layer Personal shooting SEX at a closed room hotel. Portio is pierced and ♀ falls. It’s frustrating, but the appearance of panting is the most erotic! Of

  • amateur censoredamateurinstinst-109inst109413inst-109
    • 2021-04-01
    119 min

    [VIO-012]Super Beautiful Butts Getting Fucked: Breaking In Thick Lesbian Massage Parlor

  • censoredanallesbianVIOlahaina tokaivioletVIO-012VIO012h-189vio00012
    • 2021-04-30
    235 min

    [FAVKH-003]The Ultimate Beautiful Married Woman Babes Are Secretly Making Their Adult Video Debuts Behind Their Husbands' Backs Nene-san Is A Super-Class Beautiful Wife With A Super Sensual, Perverted Body And She's Giving All Of Her Saliva,

  • jinguji temple nao yuka aoba censoredcreampiebig titsFAVKHarisebride in love dx ariseFAVKH-003FAVKH003h-1577favkh00003
    • 2021-05-04
    103 min

    FC2PPV 1801647 First shot ♥ ️ Complete appearance ♥ ️ Professional student 20 years old who looks good with long hair ♥ ️ Devoted blowjob & raw etch first experience of fair-skinned beautiful girl with beautiful legs & nice ass ♥ ️ The vaginal

  • amateur uncensoredfc2
    • 2021-05-21
    118 min

    [CAWD-218]I Had Always Loved Him, And When We Met Again After A Year Apart ... I Was No Longer A Virgin, And I Was Lonely, Living In The City On My Own, And Filled With Despair, But It Was My C***dhood Friend Who Had Cum To Rescue Me ... Youthful Cre

  • satsuki mei censoredcreampiebeautiful girlCAWDkawaiiCAWD-218CAWD218cawd00218
    • 2021-05-22
    68 min

    SIRO-4534 [First shot] [Cum convulsions body] [Foolery that dies] A slender beauty who fascinates the mermaid-like bounce on land. Her facial expression is sensual, and she climaxes many times .. AV application on the net → AV experience shooting 154

  • amateur censoredamateursirosiro-4534siro4534siro-4534
    • 2021-06-12
    119 min

    [AUKG-514]Denim Maniacs H

  • nagatsuki natsuki shizuka sugisaki censoredlesbianAUKGu krentoAUKG-514AUKG514aukg00514
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-24
    76 min

    435MFC-118 [SEX Kitchen Slender Slut] SEX is the only way to relieve stress! Big cock violently blames the delicate body of the perverted beauty Luna, and a large amount of vaginal cum shot & facial cum shot! [Shiroto Gonzo ＃ Luna ＃ 24 years old ＃

  • amateur censoredcreampieamateurmfcmfc-118mfc118435mfc-118
    • 2021-07-04
    52 min

    404DHT-0104 Raw Insertion Into A Sexless Beauty Witch Masseur For Over 10 Years Ema 48 Years Old

  • amateur censoredamateurmature womandhtdht-0104dht0104404dht-0104
    • 2021-07-07
    80 min

    259LUXU-1431 Luxury TV 1427 Former Race Queen Slender Wife Appears In AV For Stimulation! Obscene sexual intercourse that makes a horny sound from an oil-covered obscene body and cums! !!

  • amateur censoredmarried womanamateurluxuluxu-1431luxu1431259luxu-1431
    • 2021-07-08
    119 min

    [SPRD-1435]Best Aunt Rieko Hiraoka

  • rieko hiraoka censoredmature womansingle workSPRDtakara eizoutsukumo kyuutaaleddinSPRD-1435SPRD143518sprd01435
    • 2021-07-09
    139 min

    [EBOD-839]Ultimate Skinny Big Boobs Extreme Beauty Proportions Mistress Shakes Her Hips So Hard It Looks Like She'll Break Them Hedonistic Mating Adultery Trip Miyuki Arisaka

  • arisaka miyuki censoredcreampiebig titsEBODe bodymishima rokusaburoEBOD-839EBOD839ebod00839
    • 2021-07-13
    71 min

    SDJ-008 Ayumi

  • amateur censoredcreampiebig titssdjsdj-008sdj008sdj-008
    • 2021-07-14
    118 min

    [ARM-997]Swelling Peeping, Relentless Pussy Appreciation

  • aino rei sena asami honda satomi censoredARMaroma planninghamu oujiaromaARM-997ARM997arm00997
    • 2021-08-13
    97 min

    FC2PPV 2018363 Until 8/16 [Price Cut] 5980pt → 2990pt [Recorded For 1 Hour And 36 Minutes] [Appearance] [Nothing] [Teen] Premier Version With Unreleased Video Completely Recorded! I’M A Famous Shop Clerk, So To Prevent Face Baldness

  • amateur uncensoredfc2
    • 2021-08-29
    52 min

    229SCUTE-1124 Marina (24) S-Cute Squirting H Of A Neat Black-Haired Beautiful Girl

  • amateur censoredsquirtingamateurscutescute-1124scute1124229scute-1124
    • 2021-09-09
    59 min

    1Pondo 090921_001 Lesbian Sex: Nana Nanase and Rena Hiiragi

  • amateur uncensored1pondo
    • 2021-09-16
    57 min

    FCP-041 [Delivery Only] I Love Subjectivity! !! Be Careful Too Much! !! No Waiting For Ejaculation With Amazing Licking Licking Handjob! 3

  • amateur censoredamateurslutfcpfcp-041fcp041fcp-041
    • 2021-09-17
    118 min

    [MIAA-503]I Got My First Girlfriend, And So I Decided To Practice My Creampie Sex Game With my C***dhood Friend Wan Horikita

  • horikita wan censoredcreampieschoolgirlMIAAmoodyzminna no kikatanMIAA-503MIAA503miaa00503
    • 2021-09-29
    96 min

    435MFC-145 [Sexual Circumstances Of A Real Female College Student] Invite The Beauty Of The Same Sir To The Room And Sex Night! Serve A Lot Of Lotion Slimy Cancer Erection Cock In His Shirt ♪ Raw Saddle Fallen Libido Release Icharab 2 Consecutive Bat

  • amateur censoredcreampieamateurmfcmfc-145mfc145435mfc-145
    • 2021-10-09
    150 min

    [MDBK-202]The Female Doctor Who Has Big Tits: Obscene and Unprotected Sex Counseling

  • arioka miu anri namiki censoredcreampiebig titsMDBKk m producebazookaMDBK-202MDBK202mdbk00202
    • 2021-10-23
    119 min

    [GENM-093]Colossal Tits Dark Gal In Seaside Pickups! Rika Tsubaki

  • tsubaki rika censoredsingle workGENMgenekig3GENM-093GENM093genm00093
    • 2021-11-05
    230 min

    [HUNTB-133]"It"s Amazing When I Get Naked Like This!" 2 - She"s Barely Legal And Younger Than Me, But This School Friend Has An Amazing Sexy Style That Gives Me A Full Hard-on In No time.

  • censoredcreampieblowjobHUNTBhuntervolvo nakanohhh groupHUNTB-133HUNTB133huntb00133
    • 2021-11-12
    147 min

    [EBOD-869]This Beauty Specialist Is Also A Slut Genius!! She"s Worked At This High-Class Beauty Salon On Omotesando For 4 Years A Currently Active H-Cup Titty Massage Parlor Therapist Makes Her Adult Video Debut Aya Hanasaki

  • aya hanasaki censoredbig titsslutEBODe bodyarashiyama michiruEBOD-869EBOD869ebod00869
    • 2021-11-19
    238 min

    [OFJE-339]Nipple Pleasure: Now These Guys Know What Girls Feel Like: 24 Nipple Teasing Experts BEST Collection

  • tsukasa aoi yua mikami censoredslutOFJEs1 no 1 styleOFJE-339OFJE339ofje00339
    • 2021-11-19
    126 min

    [HUNBL-070]When She Took Off Her Eyeglasses, the Plain Female Employee Became an Unexpectedly Beautiful Girl. Instead of Letting Her be a Company Employee, They Made Her Become an Underwear Model...

  • censoredcreampiedeepthroatHUNBLhuntergeminihhh groupHUNBL-070HUNBL070hunbl00070
    • 2021-11-20
    137 min

    [CEMD-086]My Body And Mind Disintegrated And Became At My Beck And Call Rina Takase - Look At Me As A Lecherous Courtesan Pet.

  • rina takase censoredbig titsmature womanCEMDceleb no tomoCEMD-086CEMD086cemd00086
    • 2021-12-04
    123 min

    [GVH-326]Cunt Device Bondage, XXIV. Tied Up in Iron. Cunt Play. Nana Maeno

  • nana maeno censoreddeepthroatsingle workGVHglory questGVH-326GVH326gvh00326
    • 2021-12-09
    207 min

    [SVDVD-894]素人参加バラエティー（仮）

  • censoredcreampiebig titsSVDVDsadistic villagenyu kaji kazamashirouto sanka varietySVDVD-894SVDVD8941svdvd00894
    • 2021-12-11
    159 min

    [MDBK-212]A Certain Traditional Inn Offers the Present Age"s Red Light District in the Shadows. Creampie. Slut Club

  • nene tanaka takarada monami censoredcreampiebig titsMDBKbazookamaso knifeMDBK-212MDBK212mdbk00212
    • 2021-12-24
    116 min

    [ROE-030]I"m The Only One Who Knows... My Friend"s Mother And Her Secret Lesson Maki Tomoda

  • maki tomoda censoredmature womanmomROEmadonnajotaro tomimonroeROE-030ROE030roe00030
    • 2022-01-15
    120 min

    [JLZ-054]Mature Lesbians: The Secret Teleworking Of A Senior And Junior - Sakura Tsukishima, Nagisa Kataoka

  • tsukishima sakura kataoka nagisa censoredlesbianmature womanJLZrubytsuji koujikuroyuriJLZ-054JLZ054jlz00054
    • 2022-01-28
    96 min

    [T28-610]I"m Fucking Her 3 Times A Week - Mei F

  • censoredcreampieuniformT28tmaT28-610T2861055t2800610
    • 2022-01-29
    115 min

    [ANB-201]I Became My Stepmom"s Sex Toy. The Cute And Hot Stepmother Loves A Big Dick! Ayaka Seki.

  • seki ayaka censoredcreampiemature womanANBrubyyanoguchi susumunobleANB-201ANB201anb00201
    • 2022-01-29
    124 min

    [PKPR-007]Fresh Face One Room Swallow Documentary: Cute And Comforting Half-Japanese Beauty Ran Ayase

  • ran ayase censoredcreampiebeautiful girlPKPRpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPR-007PKPR007pkpr00007
    • 2022-02-11
    31 min

    FC2PPV 2660214 <Ex-Wife, New Year’s First Creampie> [Big Breasts Erotic Areola] <4K Shooting> Transcendental Fucking Erotic Body And Nipple Bottle Dirty Areola Vs Miniskirt & Stiletto Heels And Glossy Pantyhose Direct Wearing Man Jui

  • amateur uncensoredfc2
    • 2022-02-11
    120 min

    [PPPE-007]Full-auto Unlimited Cum Soapland That Makes You Ejaculate Once Every 5 Minutes - Hitomi

  • hitomi censoredbig titsslutPPPEoppaiPPPE-007PPPE007pppe00007
    • 2022-02-16
    47 min

    [021622-001][VR] Picked up a runaway man, so I turned it into a pet as adult toy!

  • karin nagisa uncensoredcreampiecaribbeancom
    • 2022-03-13
    61 min

    [HEYZO-2742]Yuko Amakata Sex Spree With A Busty MILF FWB

  • yuko amakata uncensoredcreampieheyzo
    • 2022-03-14
    66 min

    345SIMM-707 [Reading Notice] Lori Face Beautiful Girl I-Chan @ Shinjuku [Women ● Raw / Uniform / Blazer / Miniskirt / Beautiful Legs / A Cup / Creampie] #Underwear Voyeur #Train Molester #Home Invasion #Sleeping Rape (Ichika Matsumoto)

  • amateur censoredcreampieschoolgirlsimmsimm-707simm707345simm-707
    • 2022-03-18
    120 min

    [SSIS-355]Detestable Brother-in-law Has A Weird Foot Fetish And Uses Close-up Licking Techniques For Non-stop Pleasure On The Night Of A Family Gathering. Ichika Hoshimiya

  • ichika hoshimiya censoredSSISs one number one stylemichiru arashiyamas1 no 1 styleSSIS-355SSIS355ssis00355
    • 2022-03-21
    86 min

    [LBDD-009]Meisa Kawakita / Pure, Innocent Beautiful Girl With Black Hair

  • kawakita meisa censoredbig titsbeautiful girlLBDDmedia artsblack hair beautiful girlLBDD-009LBDD009162lbdd00009
    • 2022-04-01
    120 min

    RBK-045 Breaking In A Contractor Uika Noa

  • squid censoreddramaRBKattackerskanna flowerdragonRBK-045RBK045rbk00045



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi