high vision censored best omnibus hours more creampie




FC2NGODKBIMEYDAMBIONEZHUNTBMARAADNPPPDFSDSSCAWDSQTEAVSACHRVVENUHZGDVEMAMILKHDKASDAB

2020-12-13
132 min

[APKH-157]She'll Entice You To Ejaculation With Her H-Cup Beautiful Big Tits And Her Filthy Body #I Sent A Message Asking For An Offline Meetup Fuck With A College Girl (A Reader Model) Using A Secret Account And She Immediately Said OK! I Shut M

  • ran shion censoredcreampiebig titsAPKHaurora project annexhaurora project anexAPKH-157APKH157apkh00157
    • 2020-12-25
    59 min

    [WKD-037]Fallen Woman June Lovejoy

  • june lovejoy censoredslutsingle workWKDwaap entertainmentk westwWKD-037WKD0372wkd00037
    • 2021-01-01
    53 min

    FC2PPV 1628569 Creampie ban ❤️ Finally succeeded in ejaculation in the vagina of the finest idol class innocent lady ♪ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-01-12
    52 min

    FC2PPV 1642357 [No] [Limited number of 1000pt OFF!] Coco ● Rafa ● N working innocent girl ❤️ Such a child … Exquisite blowjob ❤️ Insertion and cum shot ❤️ Massive vaginal cum shot ❤️ * Review privilege ❤️ Complete appearance cum swallowing ❤️

  • amateur uncensoredfc2
    • 2021-01-14
    140 min

    [SPRD-1364]My Mother-in-law Is Much Better Than My Wife... Yurika Aoi

  • yurika censoredmature womansingle workSPRDtakara eizokon oriharualeddinSPRD-1364SPRD136418sprd01364
    • 2021-01-17
    160 min

    [MMKZ-090]A Cute Face And A Big Ass!! Rika Tsubaki

  • tsubaki rika censoredbig titssingle workMMKZmarrionkojiro miyamotoirisMMKZ-090MMKZ090mmkz00090
    • 2021-01-19
    139 min

    [STARS-323]Mana Is A Beautiful Lady Boss Who Hates My Guts, And I Can't Abide By That, So I'm Going To Send Her To A Massage Parlor And Have Her Converted To Fit My Tastes! Mana Sakura

  • mana sakura censoredbig titssingle workSTARSsod createryo inugamisod starSTARS-323STARS3231stars00323
    • 2021-01-23
    176 min

    [CAWD-173]Preppy College Girl From Prestigious Institution Is Also A Popular Akihabara Maid - Massive Squirting Orgasms Getting Fucked 3 Times In Sexual Awakening - Mone Kouno

  • mone kamishiraishi censoredsquirtingsingle workCAWDkawaiikannana dainanaCAWD-173CAWD173cawd00173
    • 2021-01-24
    119 min

    [NSPS-963]Going Crazy Aged 20. Living Together Half The Time: Hot Steamy Sex Between Middle-Aged Old Man And His Young Step-Daughter - Sachiko

  • sachiko censoredsingle workdramaNSPSnagae stylejotaro tomiNSPS-963NSPS963nsps00963
    • 2021-01-29
    301 min

    [SUPA-565]謹賀新年！！今年もたくさんヌかせます！！美女詰め合わせSS級福袋！！2021年お年玉ベスト

  • censoredcreampiebig titsSUPAs kyuu shiroutok tarouSUPA-565SUPA565h-244supa00565
    • 2021-01-31
    41 min

    493PKPD-084 [Leaked] Former entertainer back personal shooting JD Creampie

  • amateur censoredcreampieamateurpkpdpkpd-084pkpd084493pkpd-084
    • 2021-02-06
    64 min

    H0930 tk0028 Chikako kinugasa 36years old

  • amateur uncensoredh0930
    • 2021-02-12
    120 min

    [REAL-760]Demon Tit Fuck Hell Mako Oda

  • oda mako censoredbig titssingle workREALreal workseightreal real worksREAL-760REAL760172real00760
    • 2021-02-18
    60 min

    [oretd-845]YUKINE

  • amateur censoredcreampieuniformoretdoretd-845oretd845oretd-845
    • 2021-02-18
    121 min

    [TOEN-038]As Soon As Her Husband Steps Out, This Slutty Stepmom Is Riding Her Stepson's Cock - 10 Creampie Loads A Day... Nanako Seto

  • nanako seto censoredcreampiemarried womanTOENcenter villageyoichi sanotaoyuanTOEN-038TOEN038h-086toen00038
    • 2021-02-25
    235 min

    [SVDVD-840]One-Way Mirror Cab - Hard Boiled Anal: If You Try Our Cutting-Edge Reflexology Treatment, You'll Win 100,000 Yen! We Offered High Powered Working Babes In Ginza Anal Massages And Pleasured Them Until They Started Squirting! Their First

  • censoredanalcreampieSVDVDsadistic villagenew kage kazamamagic mirror number sadistic villageSVDVD-840SVDVD8401svdvd00840
    • 2021-03-01
    120 min

    [HDKA-228]The Naked Maid Nude Maid Service Reina Aoi

  • aoi reina censoredcreampiebig titsHDKAplanet plusdirector orafu shukoHDKA-228HDKA228h-237hdka00228
    • 2021-03-04
    115 min

    435MFC-086 Super horny slut who is immersed in pleasure by inserting two holes at the same time [Gonzo ＃ Ayaka ＃ 25 years old ＃ G cup]

  • amateur censoredcreampiebig titsmfcmfc-086mfc086435mfc-086
    • 2021-03-13
    60 min

    HEYZO 2478 Deep Kiss, Furious Sex -Make Me Wet- – Miyu Morita

  • miyu morita uncensoredcreampieheyzo
    • 2021-03-21
    33 min

    494SIKA-064 A fair-skinned beauty J ○ who is too erotic even though she is young is Ji Po begging SEX

  • amateur censoredcreampieuniformsikasika-064sika064494sika-064
    • 2021-03-27
    120 min

    [AUKG-508]Lesbian Affair ~ The Beautiful Older Woman Next Door Is A Cheating Slutty Wife With White Skin And Huge Breasts ~ Satomi Suzuki Nanao Nakano

  • satomi suzuki nanao nakano censoredlesbiandramaAUKGu krentoAUKG-508AUKG508aukg00508
    • 2021-03-29
    62 min

    292MY-433 Ami Ogawa

  • amateur censoredbig titsmarried womanmymy-433my433292my-433
    • 2021-03-31
    57 min

    292MY-454 Honda Minami 2

  • amateur censoredcreampiemarried womanmymy-454my454292my-454
    • 2021-04-15
    120 min

    [KSBJ-131]A Newly-married Stepniece Tempted By Her Stepuncle - Sachiko

  • sachiko censoredcreampiebig titsKSBJksb kikaku emmanuellebito sakuraKSBJ-131KSBJ131ksbj00131
    • 2021-04-16
    50 min

    230OREC-742 Nanao

  • amateur censoredcreampiebig titsorecorec-742orec742230orec-742
    • 2021-05-01
    153 min

    [OBA-414]My New Step Son Is A Total Hottie... Nozomi Haneda

  • nozomi haneda censoredmature womanslutOBAmadonnabieber gonzoobasanOBA-414OBA414oba00414
    • 2021-05-01
    175 min

    [DVDMS-659]Observation Porn Featuring Ordinary Men And Women X The Magic Mirror Collaboration Project. A Horny Teenager Who's Always Studying Pisses Herself And Orgasms When She Experiences Face Sitting And Cunnilingus For The First Time In Her L

  • censoredcreampiesquirtingDVDMSdeepsking of genkingdeep sDVDMS-659DVDMS659dvdms00659
    • 2021-05-21
    118 min

    [JUL-588]My Classmates Are Always Picking On Me And Bully Me By Fucking My Mom! Maki Tomoda

  • maki tomoda censoredmature womanmomJULmadonnajyoji kawaiJUL-588JUL588jul00588
    • 2021-05-22
    106 min

    [APNS-241]Married Cook At The Worker's Temporary Quarters Used As A Sex Toy Mia Hanesaki

  • mia hasaki censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-241APNS241apns00241
    • 2021-06-18
    88 min

    [OHP-1003]Rin Yuki/100 Beautiful Girl

  • yuki rin censoredbeautiful girlsingle workOHPmedia brand100 hottie media brandOHP-1003OHP1003301ohp01003
    • 2021-06-24
    100 min

    [RCTD-407]High S*********ls Spread Their Legs And Do Weird Ass Play

  • aino rei sena asami miko shion censoredanalschoolgirlRCTDrocketroot yamazakiRCTD-407RCTD4071rctd00407
    • 2021-07-02
    34 min

    520SSK-012 Erika

  • amateur censoredcreampiesquirtingsskssk-012ssk012520ssk-012
    • 2021-07-08
    128 min

    [NEO-761]Coming On Long Hair Miho Tono

  • miho tsuno censoredsingle workNEOradixsakuraba kyuu kokoro otokoneo radixNEO-761NEO761433neo00761
    • 2021-07-14
    136 min

    [GVH-264]She Had Huge Tits When She Grew Up- Hana Himesaki

  • himesaki hana censoredcreampiebig titsGVHglory questhyonGVH-264GVH26413gvh00264
    • 2021-07-18
    124 min

    [USBA-030]School Uniform Bondage: The Fetish Of A Large Breasted Girl Who Desires Sex In The Form Of Bondage, Starring Hana Himesaki

  • himesaki hana censoreduniformbdsmUSBAavs collector susubashisuiavscollector sUSBA-030USBA030usba00030
    • 2021-07-23
    150 min

    [XVSR-603]The Decisive Adult Video Debut Of A Hot Virgin Who Is Enrolled In The Department of Literature At A Certain Famous University: Moe Tateishi

  • shield moe censoredbeautiful girlsingle workXVSRmax asono kancalenXVSR-603XVSR603xvsr00603
    • 2021-07-30
    153 min

    [SSIS-140][Unusual Climax] Maximum Erotic Awakening! Non-top Fucking With Kozua Fujita Until She Is Satisfied!

  • kozue fujita censoredsquirtingbeautiful girlSSISs1 no 1 styleusapyonSSIS-140SSIS140ssis00140
    • 2021-08-21
    119 min

    [NASH-559]Ultimate Lesbian Slut! Her Sweet Kisses And Relentless Caresses Could Turn Any Girl Lesbian!

  • censoredlesbianNASHnadeshikoNASH-559NASH559nash00559
    • 2021-09-01
    82 min

    FC2PPV 2118991 [Personal Shooting] F Cup 18-Year-Old Professional Student Living In Shizuoka Prefecture Sex & Handjob Bukkake For A Total Of 2 Hours Recording For Money

  • amateur uncensoredfc2
    • 2021-09-09
    128 min

    [FGAN-047]Creampie Blooming GIrl Azusa - Azusa Misaki

  • misaki azusa censoredcreampiesingle workFGANfechi mefetish eyesFGAN-047FGAN047h-1440fgan00047
    • 2021-09-10
    61 min

    328HMDN-405 [On The Verge Of Techno Break] Newlywed Neat Wife 25 Years Old. Clitoris Hyperemia Massive Tide Splash On The Verge Of Dehydration, Seeding A Newlywed Pussy With A Demon Dick [Broken]

  • amateur censoredcreampiebig titshmdnhmdn-405hmdn405328hmdn-405
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-17
    154 min

    [BLK-523]Take Me To The Beach! Ditzy Gal With Big Tits Enjoys Sex On The Beach. No.1 Call Girl Miku-chan Puts On Swimsuit And Moans On Like Ocean Waves!!

  • censoredbig titsBLKkira kirakira hosi kira black galBLK-523BLK523blk00523
    • 2021-09-17
    55 min

    230OREC-882 Nanami

  • amateur censoredcreampieamateurorecorec-882orec882230orec-882
    • 2021-09-18
    126 min

    [JKNK-120]Showed Up For An Interview And Everyone Was Lewd! Taking The Blindfold Off To Reveal A Dick In The Face! Mature Married Woman Shows Off Desires For Getting Off.

  • aki misato asano censoredmature womanJKNKjuku no zou emanierujuku no zouJKNK-120JKNK120jknk00120
    • 2021-10-03
    54 min

    398CON-087 Keiko Akahori (60)

  • amateur censoredcreampieamateurconcon-087con087398con-087
    • 2021-10-05
    58 min

    FC2PPV 2302188 * Until 10/7 6000 ⇒ 2980 ★ First! Orgy 3p ☆ Miraculous Thirty Beauty ♥ Former Race Queen ♥ Extreme Beauty Body ♥ De M Towako 32 Years Old ♥ Sexy Beauty Confirms Meat Urinal With Continuous Vaginal Cum Shot ♥ De Transformation Iki Spree

  • amateur uncensoredfc2
    • 2021-10-09
    141 min

    [APAK-201]"My Trip With My Teacher Ended In Lots Of Sex And Giving Him Head Until My Throat Was Sore..." A Hot Springs Vacation With A Submissive S*****t, Starring Atsuko Nakajima

  • atsuko nakajima censoredcreampieschoolgirlAPAKaurora project annexrkAPAK-201APAK201apak00201
    • 2021-10-22
    87 min

    [homev-021]THさん

  • amateur censoredamateurhomevhomev-021homev021homev-021
    • 2021-10-24
    38 min

    553APLT-004 Bookmark (Shiori Mochida)

  • amateur censoredbig titsuniformapltaplt-004aplt004553aplt-004
    • 2021-10-26
    57 min

    H4610 ki211026 Yukie Sakai 26years old

  • amateur uncensoredh4610
    • 2021-10-29
    240 min

    [CLUB-659]He"s Got His Office Right Next To A Prestigious Physical Education College A Sports Trainer And Chiropractor Who Targets Only Competitive Swimmers 12

  • censoredsquirtingCLUBhentai gentleman clubCLUB-659CLUB659club00659
    • 2021-10-29
    178 min

    [JUFE-341]A Perfect Day for a Date in Tokyo. SEX With No Make-Up On. Rena Momozono

  • reina taoyuan censoredbig titssingle workJUFEfitchJUFE-341JUFE341jufe00341
    • 2021-11-05
    240 min

    [SSIS-227]Incredibly Vivid And Dynamic Video With Mature H-cup Tits In Close-up Angles. 10-Year Anniversary Premium 3 Hardcore Scenes 240 Minutes Special. Saki Okuda

  • saki okuda censoredbig titsSSISs one number one styletrendy yamaguchis1 no 1 styleSSIS-227SSIS227ssis00227
    • 2021-12-05
    121 min

    [TUE-119]Recorded Footage Of A Beautiful Girl Being Indecent In A Public Bath.

  • censoredcreampiebeautiful girlTUEglayzteito ura eizouTUE-119TUE11912tue00119
    • 2021-12-31
    126 min

    [RBK-034]A Showroom Of Sluts. Anal Sex For The Deceived New Wife. Moe Hazuki

  • moe hazuki censoredanalsingle workRBKattackerskaoru okuzonoryupakuRBK-034RBK034rbk00034



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi