hours more jav amateur censored masturbation




FC2EBODWANZAPODMVSDAMBIHODVFSDSSADNKBISQTEAVSAPPPDDASDMILKVEMANACRSANHNDNGODDTT

2020-10-24
170 min

[JUL-345]A Beautiful Woman's Equation: Beauty X Elegance X Bewitching = Honoka Kimura 34 Years Old AV Debut!!

  • honoka kimura censoredmature womansingle workJULmadonnamametaro mamezawaJUL-345JUL345jul00345
    • 2020-12-05
    238 min

    [HUNTA-904]"Stop! Please! Take It Out Already! How Many Times Are You Going To Cum In Me!？" Outstanding Cherry Boy Can't Stop Cumming Inside His Sweet Mother-In-Law No Matter How Many Times He's Already Ejaculated!

  • censoredcreampiebig titsHUNTAhuntervolvo nakanohhh groupHUNTA-904HUNTA904hunta00904
    • 2020-12-14
    55 min

    FC2PPV 1590942 [Personal shooting] Appearance / Hazuki 20 years old / 3P orgy with a cheeky busty girl (H cup)! Raw Saddle, Creampie, Massive Facials! !!

  • amateur uncensoredfc2
    • 2021-01-01
    123 min

    [SOAN-053]Volunteer Anal Service - Charitable Babes Offer Up Their Asses Out Of Philanthropy - This Time, She's Determined To Be The Star...

  • censoredanalSOANyama to soramaketaro tanizokoanal visitSOAN-053SOAN053soan00053
    • 2021-01-13
    32 min

    FC2PPV 1643479 Complete beauty re-advent! As usual, transcendental cute girlfriend and vaginal cum shot sex ♥ At the end it was too comfortable and I got out … (* noωno) * High quality version & review benefits included ♪ [Personal shooting

  • amateur uncensoredfc2
    • 2021-01-15
    122 min

    [ZEX-400]"It Looks Like You've Missed The Last Train Home..." I Have A Girlfriend, But I Went To The Corporate Apartment Of My Devilish Colleague, And She Stood There Before Me, With No Bra Or Panties On, With No Makeup On, And Hit Me Wit

  • abe mikako censoredcreampiebeautiful girlZEXpeters maxZEX-400ZEX400h-720zex00400
    • 2021-01-17
    129 min

    [BDA-132]Black Guys Unleashed! Big Black Rod - Yuka Hirose

  • yuka hirose censoredcreampiedeepthroatBDAbermuda mousouzokuichikan abashiriBDA-132BDA132bda00132
    • 2021-01-21
    130 min

    [PIYO-101]The Libido Of A Stepdaughter With Colossal Tits (And Titty Fucking) Is Making For A Lot Of Problems... vol. 2

  • censoredcreampiebig titsPIYOhyokopiero dabicchiPIYO-101PIYO1011piyo00101
    • 2021-01-23
    50 min

    450OSST-008 A mysterious girlfriend who reads in the rain found in Korea, has a visual that is as good as an idol and a transcendental constriction! Defeat Saddle with shame play while sniffing the panties that you took off!

  • amateur censoredamateurosstosst-008osst008450osst-008
    • 2021-02-04
    60 min

    H0930 ki210204 Midori Yamaoka 45years old

  • amateur uncensoredh0930
    • 2021-02-10
    43 min

    FC2PPV 1679611 [February limited sale] Hime-chan and above are unreasonable! Sorry for being too erotic. Immediately after being hit by a famous instrument, a large amount of vaginal cum shot is made to a pre-ketsu beauty man with fair skin! !! The f

  • amateur uncensoredfc2
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-03-16
    240 min

    [MXSPS-662]REQUEST - Prim, Proper Beauty Honoka Mihara

  • mihara honoka censoredbeautiful girlMXSPSmaxingMXSPS-662MXSPS662h-068mxsps00662
    • 2021-03-21
    78 min

    [scute-1103]ひなこ(20)

  • amateur censoredamateurblowjobscutescute-1103scute1103scute-1103
    • 2021-04-02
    111 min

    483SGK-020 [Impact problem work] [* Handling caution] [G milk horny beast monster] [Iki crazy lunch key 4P] [Continuous vaginal cum shot] [Actually a solid bank clerk] Everyone, this time is really an incident! !! Shocking problem work Bomb! Invasion

  • amateur censoredcreampiebig titssgksgk-020sgk020483sgk-020
    • 2021-04-13
    50 min

    FC2PPV 1768376 * Limited time 2980⇒1980pt ★ Amateur wife ☆ Pocha Lori busty wife Marimo-chan re-advents without worrying even if her 23-year-old gets caught by her husband! ☆ Perverted young wife who came to a 3P orgy with sexual desire ♥ Lust for tw

  • amateur uncensoredfc2
    • 2021-04-27
    43 min

    498DDH-010 [NTR] Plump Big Ass & G Milk Sleeps In Front Of Boyfriend … A Friend And Her Girlfriend Who Got Drunk At Home And Got To Sleep With A Small Fish [Voyeur]

  • amateur censoredbig titsamateurddhddh-010ddh010498ddh-010
    • 2021-05-01
    55 min

    484TIGER-002 Yui Nagase is back! Charismatic AV director Tiger Kosakai’s "Absolutely cut off the worries of AV actresses! !! I have started to talk about Gonzo life without permission! !! Vol.2

  • amateur censoredamateurbeautiful girltigertiger-002tiger002484tiger-002
    • 2021-05-06
    76 min

    200GANA-2482 Seriously Nampa, first shot. 1632 I should have just shown a picture of my pet … A slender busty beauty who has been played with her chemo ears before I knew it! There is a pet’s qualities, a figure that hangs down and hangs do

  • amateur censoredbig titsamateurganagana-2482gana2482200gana-2482
    • 2021-05-07
    143 min

    [IPX-652]Cheating On A Work Trip: Hot Female Employee Made To Cum By Her Hung Boss Miu Shiromine

  • shiramine miu censoredblowjobsingle workIPXidea pocketbungo maedadishIPX-652IPX652ipx00652
    • 2021-05-08
    105 min

    [VENX-036]Step Family Fun Step Mom In A Bikini She Won't Give Up On Her Dream To Go To Hawaii For Vacation... Chisato Shoda

  • shota chisato censoredcreampiebig titsVENXvenussarufakecest winntersVENX-036VENX036venx00036
    • 2021-05-10

    FC2PPV 1810325 First shot !! Limited number [Uncensored] D cup that has just become a nursery teacher this spring! ︎ Pretty disturbed back face … 2 times vaginal cum shot (feature)

  • amateur uncensoredfc2
    • 2021-05-25
    54 min

    FC2PPV 1835944 First shot ❤️ We will deliver from corner to corner of a Ubu woman who does not know the world yet [Personal shooting]

  • amateur uncensoredfc2
    • 2021-06-01
    140 min

    [SDAB-183]Tomboy Takes Her First Ever Creampie Dressed Up Like A Guy - 3 Full Fucks With Raw Dick! Nana Hayami

  • don t be quick censoredcreampiecosplaySDABsod createkyouseiseishun jidaiSDAB-183SDAB1831sdab00183
    • 2021-06-10
    133 min

    [IENF-146]Picking Up Real Amateur Wives - Would You Help Wash A Male Virgin's Stuck Foreskin？ It's Been Ages Since She's Seen A Hard Cock, So She's Ecstatic To Break Him In!

  • aichi michiru yamamoto renka censoredcreampiebig titsIENFienergytiger kosakaiienfIENF-146IENF1461ienf00146
    • 2021-06-24
    145 min

    [ABW-110]美少女と、貸し切り温泉と、濃密性交と。 14 絶対的美少女を一泊貸し切り、山奥の温泉宿へ 七嶋舞 【MGSだけのおまけ映像付き 15分】

  • amateur censoredamateurabwabw-110abw110abw-110
    • 2021-06-25
    145 min

    [MIDE-943]Fucking A Body Exploding With Sensitivity All Day Long Non-Stop Unlimited Orgasms Aphrodisiacs Squirting Ultimate Climax Shoko Takahashi

  • shoko takahashi censoredbig titssquirtingMIDEmoodyzdragon nishikawamoodyz divaMIDE-943MIDE943mide00943
    • 2021-06-26
    160 min

    [LULU-082]This Horny Bitch Mama Used Her K-Cup Colossal Tits To Drain Her Son's Friend's Cock Until It Was Bone Dry Because That's The Kind Of Vulgar Slutty Cunt She Is Eri Takigawa

  • eri takikawa misato arisawa censoredcreampiebig titsLULUlunaticsvagmanLULU-082LULU082lulu00082
    • 2021-07-23
    138 min

    [SKMJ-188]Angel's Tits "They're G-Cups" Rookie Misa Aihara's AV Debut

  • misa aihara censoredcreampiebig titsSKMJred face girlone topSKMJ-188SKMJ188h-1324skmj00188
    • 2021-08-05
    243 min

    [CVDX-458]She Twisted Her Fingers Into Her Lingerie, Until She Had Stripped To Fully Naked Glory ... A Horny Housewife Undresses - A Deep And Rich Love Affair, While Secretly Peeping At Her Alluring Body - 30 Ladies 4 Hours

  • censoredcreampiemature womanCVDXcenter villageCVDX-458CVDX458h-086cvdx00458
    • 2021-08-08
    101 min

    390JNT-027 [Extremely Erotic New Chapter, Opening! !! New Era Sns Pick-Up] ● Tender And “Immediately” Say “Sef”! !! Matching With Overwhelmingly Erotic Cute Educational Trainees! !! Defeat The Slender Body, Which Has A Certain Degree Of Sensitivity,

  • amateur censoredcreampiesquirtingjntjnt-027jnt027390jnt-027
    • 2021-08-11
    62 min

    SIRO-4588 [First Shot] [F Milk With Outstanding Elasticity] [Beautiful Ass To Be Admired] A Naive Girl With A Kissing Face With A Tense Appearance. The Finest Naked Body In The Process Of Sexual Activity Remembers A New Pleasure In The Relentless Bla

  • amateur censoredbig titsamateursirosiro-4588siro4588siro-4588
    • 2021-09-01
    127 min

    [AMBI-137]The Little Love Story Of A Barely Legal Runaway And An Older Man - Rion Izumi

  • rion izumi censoredcreampieuniformAMBIplanet plusdirector oanbibarentsuAMBI-137AMBI137h-237ambi00137
    • 2021-09-29
    69 min

    511SDK-016 [All The Details Of The Affair Scene] There Are Dates, Remote Vibes, And Gonzo. Affair Wife Immersed In Pleasure

  • amateur censoredcreampiemarried womansdksdk-016sdk016511sdk-016
    • 2021-11-05
    154 min

    [SSIS-237]While My Girlfriend Was Away, I Fucked Her Best Friend, A Beautiful Glamor Idol, From Morning Till Night! Kaoru Yasui

  • kaoru yasui censoredbig titssingle workSSISs1 no 1 stylenikusonSSIS-237SSIS237ssis00237
    • 2021-11-20
    239 min

    [NASH-608]Showa Roman Porno - Married Woman And Mature Woman Stagger Sensual Theater

  • censoredamateurmature womanNASHpinkjunichiro muromachinadeshikoNASH-608NASH608nash00608
    • 2021-11-25
    139 min

    [FANH-035]Leaked Private POV Footage Of A Model! Two Videos Of Bombshell Model M*i Begging And Pleading For Cum, And Then Climaxing While Getting Creampied!

  • censoredcreampiebig titsFANHhamedori.network secondeditionFANH-035FANH035h-1472fanh00035
    • 2021-12-07
    20 min

    FC2PPV 2497205 A Slim Young Wife Who Strips Her White Eyes With A Stick And Cums. She Was Raped On Behalf Of Her Multi-Debt Husband In A Happy House

  • amateur uncensoredfc2
    • 2021-12-16
    57 min

    1Pondo 121621_001 My Wife’s Mother And Son In Law Sex Maki Koizumi

  • amateur uncensored1pondo
    • 2021-12-24
    138 min

    [CJOD-327]"We"re Going To Cum Over And Give Your C*ck The Slut Treatment, Okay？" These Two Sweat And Sadistic Beautiful Girl Babes Gave Me Such A Cum Swallowing, Creampie Fucking, Man-Squirting Good Time, My C*ck Was Totally Busted Ichika

  • ichika matsumoto yui nagase censoredcreampiebeautiful girlCJODchijo heavensamoariCJOD-327CJOD327cjod00327
    • 2021-12-31
    120 min

    [ADN-368]I Have Sex With My Son"s Friend. Ayaka Muto

  • ayaka muto censoredsingle workdramaADNattackersjo styleotona no dramaADN-368ADN368adn00368
    • 2022-01-13
    122 min

    [FSDSS-347]From Choking Mouth Fucking To Full-on Cum Facials! Having To Do Sloppy Squirting And Tied Up Sex. Hiyori Yoshioka

  • hiyori yoshioka censoredsquirtingbeautiful girlFSDSSfalenowild sevenfaleno starFSDSS-347FSDSS3471fsdss00347
    • 2022-01-14
    243 min

    [TOMN-198]Sweaty Climax: Crazy Sexual Intercourse Where You Almost Break From A Strong Piston - BEST

  • ai mukai natsuho imai censoredbig titsTOMNteppanteppan specialTOMN-198TOMN198tomn00198
    • 2022-01-25
    74 min

    200GANA-2633 Seriously Nampa, First Shot. 1749 Picking Up A Short-Haired Older Sister I Met In Tachikawa And Heading To The Hotel! Stroking A Sticky Fair-Skinned Body … In The Afternoon On Weekdays, Men And Women Who Meet For The First Time Meet

  • amateur censoredamateurganagana-2633gana2633200gana-2633
    • 2022-01-27
    57 min

    H4610 ki220127 Sanae Kawase 26years old

  • amateur uncensoredh4610
    • 2022-01-29
    115 min

    [XVSR-635]Obscene Fuck Mao Hamasaki

  • hamazaki mao censoredcreampiebig titsXVSRmax ashanty yazawacalenXVSR-635XVSR635xvsr00635
    • 2022-02-03
    82 min

    534IND-037 Pregnancy Inevitable 2 Consecutive Creampies For Roriman Who Looks Innocent Appearance _ Childhood Remains

  • amateur censoredcreampieamateurindind-037ind037534ind-037
    • 2022-02-04
    120 min

    [HODV-21646]親友の妹が僕にだけエロい 乃木蛍

  • nogi firefly censoredHODVh m pk c takedaHODV-21646HODV216465642hodv21646
    • 2022-02-08
    42 min

    H4610 ki220208 Hikaru Komori 18years old

  • amateur uncensoredh4610
    • 2022-02-08
    36 min

    FC2PPV 2654012 [Limited Number] A 20-Year-Old Dental Hygienist Professional Student With An Innocent Body One Month After The Loss Of Virginity, I Put Semen In My Vagina For The First Time To Raise Funds For Living Alone …

  • amateur uncensoredfc2
    • 2022-03-04
    120 min

    [SSIS-348]"So Vulnerable When In Love". Lusted After Girlfriend"s Sister And Fucked Her Secretly. I"m Just The Pits. Nanami Ogura

  • nanami ogura censoredbeautiful girlsisterSSISs1 no 1 stylesapporo taroSSIS-348SSIS348ssis00348
    • 2022-03-05
    240 min

    [NASH-655]The Bride"s Mother. My Mother-in-law Is Much Better Than My Wife! Giving Into Scandalous Sex For A Forbidden Household Tale Of Adultery. 4 Performers, 4 Hours.

  • rieko hiraoka tomoka takase censoredmilfmature womanNASHpinknadeshikoNASH-655NASH655nash00655
    • 2022-03-11
    160 min

    [EBOD-899]Beautiful Busy Family Slut Harem. Upper Class Neighborhood Girls Get Continuously Fucked and Creampied Day After Day. Miri Mizuki, Kyoko Maki , Yuuri Asada.

  • mizukawa violet maki kyoko censoredcreampiebig titsEBODe bodygoemonEBOD-899EBOD899ebod00899
    • 2022-03-18
    69 min

    534IND-047 Short-Haired Beauty That Looks Fortunate _ 2 Shots Without Permission To A Woman Who Feels With Tears

  • amateur censoredcreampieamateurindind-047ind047534ind-047
    • 2022-03-19
    68 min

    567BEAF-007 Both 2d And 3d Love Handsome Gacha Crazy Gachis I’m Lonely And Unfriendly, But Slender And Slender Legs Soshage Billing Girl Sachi-Chan 23 Years Old

  • amateur censoredcreampieamateurbeafbeaf-007beaf007567beaf-007
    • 2022-04-09
    300 min

    DVAJ-570 Naughty Woman Teases Him By Pulling Out His Cock From Fucking As It Is About To Explode And Then He Shoots All Over. BEST.

  • riho fujimori hasumi claire censoredslutDVAJalice japansagi kandaDVAJ-570DVAJ570dvaj00570



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi