housewife infidelity high vision censored big tits




FC2AUKGMIDVSPRDHDKAMIDEATIDFSDSSNNPJWANZAVSAPREDKSBJNACRSSNIVEMACAWDIPXSDABMIAAADN

2021-01-08
172 min

[HAWA-235]She Never Fucks Her Husband Raw, But This Neat And Clean Beautiful Married Woman From The Neighborhood Will Let Fuck Her Raw In This Petite NTR Sex Life Journal Nozomi 27 Years Old

  • censoredcreampieHAWAcosmos eizohidemonkcosmospictures soft on demandHAWA-235HAWA2351hawa00235
    • 2021-01-13
    38 min

    230ORE-740 Shiori 4

  • amateur censoredcreampieschoolgirloreore-740ore740ore-740
    • 2021-01-15
    115 min

    [PARATHD-3084]Popular AV Actress Rubs Against Me In The Darkness Of The Night (4) Complete Edition - Nozomi Hazuki Edition

  • nozomi hazuki censoredbig titsPARATHDparadise tvPARATHD-3084PARATHD3084parathd03084
    • 2021-01-18
    69 min

    IDJS-028 Chikako

  • amateur censoredcreampieamateuridjsidjs-028idjs028idjs-028
    • 2021-01-22
    250 min

    [DNW-108]Hooking Up In Seconds Flat!! Sudden Sex!! Instant Fucking & Instant Orgasms 3

  • censoredcreampiebig titsDNWprestigedocumentDNW-108DNW108118dnw00108
    • 2021-01-23
    239 min

    [REXD-350]Possessed Residents - Homes Haunted By Girl Ghosts "I Want To Be Fucked By Huge Cocks!"

  • censoredcreampieREXDredmanji groupREXD-350REXD350rexd00350
    • 2021-01-25
    100 min

    [SLRO-005]A 34 Year Old Mature Manners Teacher Is A Late Bloomer And Stars In Non-nude Erotica!/Hanae Tsubaki

  • amateur censoredbig titsbeautiful girlSLROintec incSLRO-005SLRO005
    • 2021-01-29
    55 min

    [PARATHD-3081]All About The Big Tits: Sex With Braless Busty Babes (6)

  • censoredbig titsPARATHDparadise tvPARATHD-3081PARATHD3081parathd03081
    • 2021-01-29
    58 min

    490FAN-085 Aoi

  • amateur censoredbig titsamateurfanfan-085fan085490fan-085
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-13
    68 min

    275OCHA-082 U66

  • amateur censoredamateurbeautiful girlochaocha-082ocha082275ocha-082
    • 2021-02-19
    103 min

    [VENX-009]My Bride's Mother Is Filling Out As A Banging MILF And It's Getting Me Hard Chitose Yuki

  • chitose in the evening censoredcreampiebig titsVENXvenusmajime kitanofakecest winntersVENX-009VENX009venx00009
    • 2021-03-03
    60 min

    SIRO-4439 [First shot] [Very libido with withdrawal thoughts] [Must see pushing up from below] A girl with withdrawal thoughts who repeats masturbating. The body is naive to the pleasure given by the first shooting .. AV application on the net → AV e

  • amateur censoredamateursirosiro-4439siro4439siro-4439
    • 2021-03-12
    90 min

    [DPL-009]RV Sex Aori Arihoshi 22 Years Old

  • aori arisei censoredDPLplay entertainmentDPL-009DPL009h-1557dpl00009
    • 2021-03-19
    112 min

    [HALE-001]Fucking The Mama Friends Loop Vol.1 Hinako

  • censoredamateurHALEhalentino daydream tribehalentinoinfinite loop eating my mom s frienHALE-001HALE001hale00001
    • 2021-04-09
    71 min

    FC2PPV 1761894 [Limited to 100 pieces 1000pt off] Slender beauty miniskirt legs pantyhose breaking continuous cum ❤️ Succubus daughter’s stakeout piston & nipple blame ❤️ 2 consecutive ejaculations in a tiny vagina ❤️ * Review privilege [No p

  • amateur uncensoredfc2
    • 2021-04-12
    142 min

    [HONB-212](Rui) Big Titty Hostess (Mina) Cheerful Skinny Slut

  • censoredbig titsbukkakeHONBmercurythe first shibuya special f e headquarHONB-212HONB212h-1133honb00212
    • 2021-04-14
    146 min

    [PPPD-919]She Quietly Busts Her Patients' Nuts In The Middle Of Their Dental Treatments - Horny H-Cup Dental Hygienist's Porn Debut Yuno Homura

  • homura yune censoredbig titssingle workPPPDoppaiPPPD-919PPPD919pppd00919
    • 2021-04-15
    81 min

    [REBD-549]Yuuka Sexy monSTAR/Yuka Hoshi

  • yuka hoshi censoredsingle workREBDrebeccachikara sawamuraREBD-549REBD549h-346rebd00549
    • 2021-04-15
    123 min

    [BBTU-010]You'll Swoon With Pleasure! Breast Oil Massage, Slow Titty Fuck & Slow Sex Yuria Yoshine

  • yoshine yuria censoredbig titsblowjobBBTUdogmatenunmy boyneBBTU-010BBTU010bbtu00010
    • 2021-04-16
    45 min

    509JPAK-009 Arisa

  • amateur censoredbig titsuniformjpakjpak-009jpak009509jpak-009
    • 2021-04-18
    131 min

    [ANZD-075]Pure Amateur Babes Get Horny For Wild Fucks After A Little Liquor!

  • censoredamateurANZDanzu daydream vacationanzuANZD-075ANZD075anzd00075
    • 2021-04-23
    123 min

    [MIAA-428]This Real-Life Nurse Makes Men Cum In Bondage In Her Spare Time! Massive Loads Of Male Squirting - Tied Up And Ravished For Every Last Drop Of Seed By A Masterful Domme Slut Mikako Horiuchi, Age 23

  • mikako horiuchi censoredcreampieslutMIAAmoodyzmiyoshi rushereveryone s porn starMIAA-428MIAA428miaa00428
    • 2021-04-26
    74 min

    259LUXU-1415 Luxury TV 1396 AV Appearance To Dissipate The Libido That Beautiful Yoga Instructors Have Accumulated! The flexible hip joint cultivated in yoga and the bold open legs are a masterpiece! The meat butt that shakes every time it is pistone

  • amateur censoredamateurluxuluxu-1415luxu1415259luxu-1415
    • 2021-04-27
    51 min

    490FAN-050 Yui 1

  • amateur censoredcreampieamateurfanfan-050fan050490fan-050
    • 2021-05-08
    245 min

    [KDMI-035]High Leg Fantasy Amazing

  • kimishima mio yano tsubasa censoredKDMImiludopamixKDMI-035KDMI035kdmi00035
    • 2021-05-12
    91 min

    [C-2637]Married Woman POV Cuckold Confession Video 13

  • hirosaki ayaka censoredmarried womanCgogoscore gogo sC-2637C2637
    • 2021-05-20
    164 min

    [SW-777]"Are You Still A Cherry Boy？ What A Joke. Well Then, I'm Very Experienced In Sex, So Shall I Help You Graduate？" My C***dhood Friend Had Grown Up To Become A Slutty Bitch, And She Laughed At Me, Showing Off Her Panties And Titties

  • censoredSWswitchlight fujimaswitch switchSW-777SW7771sw00777
    • 2021-06-01
    66 min

    SIRO-4543 [First shot] [New teacher’s holiday] A Japanese language teacher who makes a naughty voice to a curving phallus and is disturbed in front of the camera. To the lascivious words that a neat face teacher speaks .. AV application on the n

  • amateur censoredamateursirosiro-4543siro4543siro-4543
    • 2021-06-02
    481 min

    [RVG-134]Naughty Elderly Care BEST vol. 16

  • hanasaki ia uno sakina abe sakina censoredmarried womanRVGglory questRVG-134RVG13413rvg00134
    • 2021-06-17
    51 min

    H0930 ki210617 Yoshiko Yamauchi 31years old

  • amateur uncensoredh0930
    • 2021-06-18
    20 min

    10musume 061821_01 Let me give you a head deeper Ryoko Kimijima

  • amateur uncensored10musume
    • 2021-06-19
    120 min

    [CAWD-227]Receptionist Gets Bred By Rough Sex During An Oil Massage - Confined And Made To Fuck Moko Sakura

  • sakura moko censoredcreampieCAWDkawaiiCAWD-227CAWD227cawd00227
    • 2021-06-26
    186 min

    [JKSR-497]Will You Have A D***k With Me Ma'am？ We Tried Getting A Married Woman To Swallow Liquor - And Cum. @ Shinjuku - Rural Wives Only - Picking Up Married Girls At A Bus Stop With Reasons To Cheat 12

  • censoredamateurJKSRbig morkalprink junkyJKSR-497JKSR49757jksr00497
    • 2021-07-02
    160 min

    [JUL-644]Yuko Shiraki Adult Style Skills Honed By Years Of Experience Documentary Drama Featuring Actress Yuko Shiraki

  • shiraki yuko censoredbig titsmature womanJULmadonnamametaro mamezawaJUL-644JUL644jul00644
    • 2021-07-14
    34 min

    FC2PPV 1922324 Until 21 1480 [no] Former Idol Latin Slender Beautiful Girl. She Forcibly Inserts A Meat Stick Into The 18-year-old Female Hole That She Dislikes And Vaginal Cum Shot.

  • amateur uncensoredfc2
    • 2021-07-27
    71 min

    300NTK-612 [Namaiki Kansai Beauty Gal Kimo Uncle Ji ○ Seeded Pleasure Fell! !! ] Fucking Cheeky P Activity Expedition Gal Negotiations & Netinechi Uncle Tech And Pleasure Fell From Disgust In The Direction Of Pleasure! !! The Temptation To Insert

  • amateur censoredcreampieamateurntkntk-612ntk612300ntk-612
    • 2021-07-27
    99 min

    [MDVHJ-035]The Indecent Sex Life Of An Older Man Living In A Widow's C***dren's Room - Rieko Hiraoka

  • rieko hiraoka censoredmature womansingle workMDVHJgraffiti japanmovieMDVHJ-035MDVHJ03548mdvhj00035
    • 2021-07-31
    139 min

    [PKPR-001]Lover"s lovemaking document: A beautiful girl with a great personality who you can spend the rest of your life with.

  • ai kawana censoredcreampiebeautiful girlPKPRpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPR-001PKPR001pkpr00001
    • 2021-08-03
    61 min

    422ION-0075 Bringing Her Too Beautiful Friend To The Hotel And Creampie NTR

  • amateur censoredcreampiesquirtingionion-0075ion0075422ion-0075
    • 2021-08-06
    149 min

    [HODV-21596]I Filmed An AV! A Convenient Devilish Little Slut With G-cup Breasts - Yuka Hoshi

  • yuka hoshi censoredcreampiebig titsHODVh m pHODV-21596HODV215965642hodv21596
    • 2021-09-09
    43 min

    [IENFH-008]I Was Playing Pranks On My Big Stepsister That Night, But Then She Turned The Tables On Me And Fucked Me Raw, And I Was About To Cum, But Then She Locked Me Down With Her Legs And I Couldn"t Escape, So I Ended Up Creampie Cumming Insid

  • sakura tsuji censoredcreampieIENFHi energychrysanthemumienfIENFH-008IENFH0081ienfh00008
    • 2021-09-10
    218 min

    [HUNTB-088]"I"ll Be Sure To Jerk You Off Nice And Slow!" "Uh-Oh, Are You Going To Cum？" "Hey! I Said Not Yet!" A Serious Study Session Turns Into A Fuck Session!

  • censoredcreampieblowjobHUNTBhunterkoichi davidsonhhh groupHUNTB-088HUNTB088huntb00088
    • 2021-09-15
    72 min

    FC2PPV 2207832 Up To 22 2180 [None] A Fair-Skinned Slender 19-Year-Old Student Toy. Deceive The Girl Who Works Hard For School Expenses And Forcibly Vaginal Cum Shot.

  • amateur uncensoredfc2
    • 2021-09-17
    124 min

    [FOCS-022]Warped Gal Working At A Girl"s Bar [Target] Raids The House! She Gets D***ks And Sex And Becomes A Squirting Slut! Liquor And Meat Forest Sex Yui Nagase

  • yui nagase censoredcreampiesquirtingFOCSabc mousou zokufocusFOCS-022FOCS022focs00022
    • 2021-09-23
    119 min

    [TOEN-050]There"s Nothing To Do In The Country During Summer, And Now This Widow Is Having Sweaty Sex With Her Little Brother-In-Law, Who Has Just Cum Home, Every Day Marika Kobayashi

  • marika kobayashi censoredcreampiemature womanTOENcenter villageyoichi sanotaoyuanTOEN-050TOEN050h-086toen00050
    • 2021-09-24
    161 min

    [HMN-041]Young Lady Who Works At Traditional Japanese Restaurant In Nihonbashi, Tokyo Rima Kamishiro

  • kamidai rima censoredcreampieblowjobHMNhonnakamamezawa mametarouHMN-041HMN041hmn00041
    • 2021-09-24
    78 min

    520SSK-028 [Sex Appealing Strongest Beauty Who Seduces Infinitely] Everything From Looks To Voice Is Seduced By A Fascinating Beauty And A Dirty Date For The Rest Of Her Life! !! In The Car On The Move, I’m Stimulating Po, And I’m Going To

  • amateur censoredcreampiebig titssskssk-028ssk028520ssk-028
    • 2021-10-02
    84 min

    300MAAN-703 [Smile ○ Adorable ○ Masturbation Friend No1 Who Wants To Be With All The Time! !! ] Nama Nama JD Who Uses The Erotic Chat Found On SNS As A Part-Time Job Is Persuaded! !! Actually, I … I Prefer To Lick Raw Cheeks Instead Of Over The

  • amateur censoredamateurmaanmaan-703maan703300maan-703
    • 2021-10-22
    154 min

    [DASD-926]My Cute Girlfriend That Loves Me Was Being Mating Pressed By My Stepfather. Ranka

  • ranka censoredcreampiesingle workDASDdasmishima rokusaburoDASD-926DASD926dasd00926
    • 2021-10-23
    241 min

    [SUPA-596]I Need A Cock Right Now! Repressed Hot Young Wife Can"t Resist Adultery 50 Women 4 Hour Fuck Highlights!!

  • censoredcreampiebig titsSUPAclass s amateurtaro kSUPA-596SUPA596supa00596
    • 2021-11-05
    162 min

    [FFFS-033]Bringing Mature Women! Married Women Playing With Other Men"s Cocks! All 30 Voyeur Documents - An Older, Sexually Frustrated Relative Who Commits Obscene Acts With Her Cute Nephew - Natsuki-san, G-cup, 38 Years Old, Auntie Natsue-san, H

  • censoredmature womanslutFFFSprivate mousozokugroupFFFS-033FFFS033fffs00033
    • 2021-11-17
    85 min

    435MFC-159 [Raw Saddle Sex Treatment Friends @ Big Breasts Shaved College Student] Glamorous Body Muchimuchi JD Saffle And Gonzo Sex From Midday ♪ I Can’t Stop Seriously With Sex Toys And I Haven’t Waited For Reason Collapse! !! !! Thick Va

  • amateur censoredcreampiebig titsmfcmfc-159mfc159435mfc-159
    • 2021-11-19
    95 min

    277DCV-194 Is It Okay To Send It Home？ Case.188 Beautiful "Supreme Standing Back" [8 Heads, G Cup, Waist 56 Cm, Ultimate Beauty Body, Sp] ⇒ Tears On Your Nasty Face … No Problem In The Neighborhood! Full Throttle 100 Iki Crazy ⇒ I Want T

  • amateur censoredbig titsamateurdcvdcv-194dcv194277dcv-194
    • 2021-11-20
    120 min

    [APNS-265]Bad Mortgaged Wife Riona Hirose

  • rio hirose censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-265APNS265apns00265
    • 2021-12-09
    158 min

    [SW-816]I Always Loved You. I Wish You Would Have Told Me That Sooner ... After Getting Married, She Was Hooked On The Temptation Of Committing Adultery With Her Colleague, And During A Business Trip, When They Were Booked Into The Same Room, They Fu

  • kinoshita ayame censoredblowjobsingle workSWswitchraito fuji makotoswitch hibinoSW-816SW8161sw00816



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi