housewife javcensored mature woman nampa jav




FC2ATIDJUFEKBIKSBJGVHONEZADNHNDPPPDSANFSDSSDASDMIAAMVSDMIDEMEYDSPRDAMBIDTTWAAA

2020-11-19
151 min

[TIKB-097]This Delicate Girl With Small Breasts Has A Full Body Erogenous Zone. She Transforms Into A Masochist.

  • censoredcreampieschoolgirlTIKBtikitiki.comerTIKB-097TIKB097tikb00097
    • 2020-11-22
    103 min

    [OAE-202]Premonition Of Dangerous Love Shoko Takahashi

  • shoko takahashi censoredsingle workOAEaircontrolOAE-202OAE202oae00202
    • 2020-11-26
    481 min

    [FCDSS-005]Sex Goddesses - Suzume Mino - First Best FALENO Debut 1st Anniversary - 8 Titles, 8-Hour Special

  • suzume mino censoredbig titssingle workFCDSSfalenofaleno starFCDSS-005FCDSS0051fcdss00005
    • 2020-11-27
    46 min

    [opcyn-122]うらら(24)

  • amateur censoredcreampieamateuropcynopcyn-122opcyn122opcyn-122
    • 2020-12-11
    121 min

    [SABA-664]Married Woman In Full POV: Just The Two Of Them In Love Hotel Adultery Tryst, With Raw Creampie (Alias) 28 Years Old

  • censoredcreampieamateurSABAskyu shirototodoSABA-664SABA664h-244saba00664
    • 2020-12-24
    116 min

    [SHIC-196]My Sexy Little Stepsister Wears A Frumpy Sweatshirt

  • censoredcreampiebig titsSHICadolscence.comSHIC-196SHIC196h-839shic00196
    • 2020-12-31
    63 min

    345SIMM-586 Beautiful Breasts Young Wife Enjoys Creampie 3 Times According To Home Cheating Video

  • amateur censoredcreampiemarried womansimmsimm-586simm586345simm-586
    • 2021-01-08
    162 min

    [HEZ-236]Married Women Share Their Adulterous Experiences! Let's Forget About Our Sins Together! A Threesome With Two Married Women Will Make You Feel Like A King! Luxury Pick Up Sex 3

  • censoredbig titssquirtingHEZhot entertainmentnetsuyujinhitotzuma hot entertainmentHEZ-236HEZ23659hez00236
    • 2021-01-08
    125 min

    [GUN-846]Breast Milk Slut Ami Kasai

  • kami ami censoredcosplayslutGUNradixshio sakurababatsugun paradoxGUN-846GUN846433gun00846
    • 2021-01-09
    150 min

    [EBOD-796]She Gets Looser When She's Had Liquor - I Scored A Babe (In Her 20s) With Colossal Tits At A Bar And Took Her Home For A Raw Fuck (<3)

  • censoredcreampiebig titsEBODe bodyyurukoEBOD-796EBOD796ebod00796
    • 2021-01-16
    480 min

    [HHOY-007]"No... After All, I Have A Boyfriend..." An NTR Special! Highlights Of Girls Who Have Boyfriends, But Went With The Flow, And Ended Up Having Sex!

  • censoredHHOYoyashoku.companyhhh groupHHOY-007HHOY007hhoy00007
    • 2021-01-19
    139 min

    [STARS-323]Mana Is A Beautiful Lady Boss Who Hates My Guts, And I Can't Abide By That, So I'm Going To Send Her To A Massage Parlor And Have Her Converted To Fit My Tastes! Mana Sakura

  • mana sakura censoredbig titssingle workSTARSsod createryo inugamisod starSTARS-323STARS3231stars00323
    • 2021-01-22
    244 min

    [MGT-133]Amateur Perversion Revolution vol. 04

  • censoredcreampiebig titsMGTprestigemegatraMGT-133MGT133118mgt00133
    • 2021-01-23
    309 min

    [FTOM-002]POV With Amateurs Found Via SNS: Shaved Pussy Amateurs, 4 People, 5 Hours Special

  • censoredamateurblowjobFTOMfuutubeakiba masatoamateur gonzo circleFTOM-002FTOM002h-1068ftom00002
    • 2021-01-24
    155 min

    [NSPS-964]Lusty Wives Crave Other Men's Bulges

  • yuri nikaido sumire seto censoredmature womandramaNSPSnagae stylejotaro tomiNSPS-964NSPS964nsps00964
    • 2021-01-27
    239 min

    [GAVHJ-032]Picking Up Hot Married Babes 5! Sensitive, Beautiful Booty! Married Sluts With Beautiful Tits Get Nailed Raw! 10 Creampie Loads! 4 Hours!

  • censoredcreampiebig titsGAVHJgraffiti japangati graffiti japanGAVHJ-032GAVHJ03248gavhj00032
    • 2021-02-03
    62 min

    FC2PPV 1670524 ★ Amateur ☆ Love juice Tara Tara’s Buddha half TATOO beauty ♥ Sophie 23 years old re-advents ☆ Electric blame bicubic ascension ♥ Ochinchin love best blowjob ♥ Deep vaginal insertion Gachi cum shot ♥ [Personal shooting] * With ben

  • amateur uncensoredfc2
    • 2021-02-03
    124 min

    496SKIV-003 Mana who loves raw squirrel

  • amateur censoredamateurskivskiv-003skiv003496skiv-003
    • 2021-02-17
    119 min

    435MFC-081 [Saddle and Gonzo] Gonzo with a beautiful body of Ero Riva of de S & de M! * Honoka / 23 years old / working at a cafe

  • amateur censoredcreampieamateurmfcmfc-081mfc081435mfc-081
    • 2021-02-21
    122 min

    [DASD-818]The Golden Shower Domain This Sch**lgirl Was Receiving Breaking In Piss Training By A Teacher With Abnormal Sexual Hangups And Now She's Dribbling Her Holy Waters Down Her Crystal Pure Thighs Mao Watanabe

  • mao watanabe censoredcreampiesquirtingDASDdassDASD-818DASD818dasd00818
    • 2021-02-22
    84 min

    [MCKT-016]Hot Girls Who Love To Party! Girls Pick Up Guys To Fuck On The Street Corner Hibiki Otsuki

  • otsuki sound censoredcreampieMCKTchikikikikama delusion groupMCKT-016MCKT016mckt00016
    • 2021-02-23
    72 min

    200GANA-2444 Seriously Nampa, first shot. 1602 A fashionable celebrity married woman who suffers from sexlessness even though she is a newlywed found in Omotesando! Frustrated with having sex 3 months ago! The libido that was suppressed by stimuli ot

  • amateur censoredbig titsmarried womanganagana-2444gana2444200gana-2444
    • 2021-02-25
    108 min

    [MILK-104]Geisha Brothel - Traditional Japanese Sex Work - Riona Minami

  • rina minami censoredcosplaybeautiful girlMILKmilkMILK-104MILK104h-1240milk00104
    • 2021-03-05
    122 min

    [UMD-769]I Was In The Hospital For So Long That I Got A Hard On Even For This Old Lady Nurse's See-Through Pants 2

  • kimishima mio aishin shinkawa censoredsluthandjobUMDleodragon nishikawaUMD-769UMD769125umd00769
    • 2021-03-05
    243 min

    [BUR-566]Creampie Sex In The Bathtub - 12 Stepdaughters, Little Stepsisters, And Big Stepsisters - 4 Hours

  • censoredcreampiebeautiful girlBURglay zburst graceBUR-566BUR56612bur00566
    • 2021-03-06
    240 min

    [HUNTA-963]"Finally, I've Given You An Erection ... After All, Look At How Excited I Am Too" And My C***dhood Friend Let Me Touch Her Pussy, And I Could See How Dripping Wet It Had Become, And It Was Nice And Sticky, And Then I Could No L

  • censoredschoolgirlblowjobHUNTAhuntermorikihhh groupHUNTA-963HUNTA963hunta00963
    • 2021-03-13
    71 min

    499NDH-008 Have Sex For Your Favorite Boyfriend! Inexperienced Ubukawa Nagano kid is skillfully fooled into sexual skills instruction! I’m crazy about my first electric machine! The second vaginal cum shot in my life is done well! [GoTo users on

  • amateur censoredcreampieamateurndhndh-008ndh008499ndh-008
    • 2021-03-19
    63 min

    FC2PPV 1694498 [Limited quantity 2980pt → 1980pt] Legendary Pukuman ❤️ Active cosmetic surgery esthetician Kaho who was deceived by massage recruitment ❤️ Plump and thick Oma ○ This is a permanent preservation version Many purchase benefits

  • amateur uncensoredfc2
    • 2021-03-19
    44 min

    FC2PPV 1733281 ☆ Youkai prey 2 ☆ Three consecutive pulsed vaginal cum shot [No

  • amateur uncensoredfc2
    • 2021-03-25
    101 min

    300MAAN-639 [Feeling Momojiri Bishoujo and Super Rich 3 Squeezing] "Ayaka-san" Marunage Request! "I want to know a lot about alcohol and naughty!" A beautiful girl with a smile of 120 points! A date course with bare desires! Sharpen y

  • amateur censoredcreampieamateurmaanmaan-639maan639300maan-639
    • 2021-03-26
    76 min

    [FTHT-010](Godly Ass! Beautiful Legs! Overwhelming Cuteness! Moans Of Pleasure! Tall, Gorgeous Model) Her Panties Are Soaked With Just A Kiss! When A Vibrator Is Applied To Her Sensitive Pussy She Loses Her Mind! Rock Hard Nipples And Big, Bouncing B

  • censoredcreampieFTHTfalenodavielfalenotubeFTHT-010FTHT0101ftht00010
    • 2021-04-16
    66 min

    230OREC-752 Marina-chan

  • amateur censoredcreampieuniformorecorec-752orec752230orec-752
    • 2021-04-18
    142 min

    [APKH-172]She'll Grab Your Dick! This Big Booty Slut Is Crazy For Cock - Wild POV Footage Ayumi Manaka

  • ayumi aika censoredblowjobsingle workAPKHaurora project annexhaurora project anexAPKH-172APKH172apkh00172
    • 2021-05-02
    47 min

    188HINT-0457 Seiko

  • amateur censoredcreampiebig titshinthint-0457hint0457188hint-0457
    • 2021-05-14
    160 min

    [DVDMS-667]I Was Robbed Of 16 Cum Shots Of My Semen During A Lovey-Dovey 2-Day, 1-Night Creampie Hot Spring Resort Vacation She Was An Adorable, Sweet Young Thing, Like An Angel Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlDVDMSdeep sostracismDVDMS-667DVDMS667dvdms00667
    • 2021-05-20
    181 min

    [SW-776]When His Son's Wife Was Being Deprived Of Sex, It Was Such A Shame Letting Her Big Tits Go To Waste, So She Decided To Show Them Off And Lure Him To Temptation! "Father-In-Law, I Think You Should Take Responsibility For The Way Your S

  • censoredbig titsSWswitchyocchanswitch switchSW-776SW7761sw00776
    • 2021-05-20
    243 min

    [CVDX-449]A Mature Woman Is Squeezing The Life Out Of My Ecstatic, Rock Hard Cock, With Piston-Pounding Creampie Sex So Good It Makes My Brain Melt, As I Sank Into A Twisting, Sloppy, Swamp Of Orgasmic Pleasure. 40 Ladies 4 Hours

  • censoredcreampiemarried womanCVDXcenter villageCVDX-449CVDX449h-086cvdx00449
    • 2021-05-25
    96 min

    [NUBI-051]Go To S******g Fuck: Playing A Prank On S******g College Girls By Fucking Them

  • censoredamateurbukkakeNUBIkalimantannubiaNUBI-051NUBI051h-1112nubi00051
    • 2021-06-16
    34 min

    FC2PPV 1871114 First shot! !! Limited number [Uncensored] "Teacher is embarrassing …" An innocent student who is pleased with panting. Fornication class for boyfriend! Creampie twice! !!

  • amateur uncensoredfc2
    • 2021-06-24
    110 min

    [RCTD-408]Daydream Item Ultimate Evolution Series: The Brush Pen That Transforms Humans Into Fuck Dolls Arisu Toyonaka

  • alice toyonaka censoredsingle workRCTDrocketcentral yamamotoRCTD-408RCTD4081rctd00408
    • 2021-07-02
    67 min

    230OREC-819 Aoi sensei

  • amateur censoredcreampieamateurorecorec-819orec819230orec-819
    • 2021-07-02
    213 min

    [HUNTB-048]My Sister-In-Law Is Always Waiting For My Big Brother To Come Home After Working Overtime, Late Into The Night, And Since She's Super Horny, I'm Always Fucking Her Brains Out For 8 Hours At A Time Until He Returns Home. 2

  • censoredcreampieblowjobHUNTBhunterkawajirihhh groupHUNTB-048HUNTB048huntb00048
    • 2021-07-02
    166 min

    [SSIS-104]* Absolutely No Script!! POV Fuck! No Makeup! It's All Here! The True Dirty Nature Of Saki Okuda Is Revealed In This Exposed Fuck Session!! A Super Rare Film Of This Real Couple's Hot Spring Trip With Nonstop Fucking, Too Raw And Sh

  • saki okuda censoredbig titssingle workSSISs1 no 1 stylearashiyama michiruSSIS-104SSIS104ssis00104
    • 2021-07-14
    170 min

    [SSIS-129]Saika Kawakita. Re:start!

  • ayaka hebei censoredbig titsbeautiful girlSSISs1 no 1 stylekyoseiSSIS-129SSIS129ssis00129
    • 2021-07-22
    205 min

    [SSIS-164]A Premium Edition Featuring Previously Unreleased Footage! Director's Cut Saika Kawakita In Her Thrilling, Nervous, First Experiences Working At A Sex Club A 7-Servings Full Service Hospitality Course

  • ayaka hebei censoredblowjobbeautiful girlSSISs1 no 1 stylemon cSSIS-164SSIS164ssis00164
    • 2021-07-23
    146 min

    [XVSR-605]AV Actress Kotone Suzumiya Is Retiring - Last Message -

  • kotone suzumiya censoredbeautiful girlsingle workXVSRmax asono kancalenXVSR-605XVSR605xvsr00605
    • 2021-08-12
    119 min

    [FSDSS-281]Fucking My Boss"s Daughter When She Comes To Me Naked Asking For Help, Kaname Momojiri

  • kaname momojiri censoredbig titsdeepthroatFSDSSfalenoyamaguchi memberfaleno starFSDSS-281FSDSS2811fsdss00281
    • 2021-08-14
    119 min

    [HALE-006]Mom Friend Hunting, Infinite Loop Vol. 6, Lilia Masochist Swallowing Gal Mommy Climax LUSH

  • censoredamateurHALEhalentino mousouzokuhalentinomamatomo kui mugen loopHALE-006HALE006hale00006
    • 2021-08-20
    44 min

    FC2PPV 2053406 [First Shot ♥] It Seems That Women Who Can Work Have No Luck. I Entered The Hotel One Night And Took A Gonzo Shot ♥♥

  • amateur uncensoredfc2
    • 2021-08-20
    154 min

    [CAWD-262]It"s Been 3 Months Since I Started Keeping A Runaway Daughter - Record Of Raising And Impregnating Her Until She Totally Became Mine - Yumeru Kotoishi

  • yume kotoishi censoredcreampiedeepthroatCAWDkawaiitake dCAWD-262CAWD262cawd00262
    • 2021-08-21
    60 min

    Caribbeancom 082121-001 Reflexology With A Cutie In Sailor Uniform Mikuro Komori

  • mikuro komori uncensoredcreampiehandjobcaribbeancom
    • 2021-09-10
    477 min

    [OFJE-328]Celebrity Riri Nanatsumori First-Time Best S1 Debut 1-Year Anniversary. Latest 11 Titles, 8-Hour Special

  • nanatsumori riri censoredbeautiful girlsingle workOFJEs1 no 1 styleOFJE-328OFJE328ofje00328
    • 2021-09-24
    137 min

    [JUL-718]This Married Woman Was Unleashing A Furious Windstorm Of Ass-Shaking Sex, Dripping With Sweat, And I Ended Up Creampie Injecting Her Without Ever Moving A Muscle. Maiko Ayase

  • maiko ayase maria sawaguchi censoredcreampiemature womanJULmadonnakoyama masatsuguJUL-718JUL718jul00718
    • 2021-09-27
    48 min

    328HMDN-411 [Individual, Forty] Creampie Seeding To The Mother Of A Friend Of K Cup. Punishment Limit Sex With Big Breasts Full Of Oil

  • amateur censoredcreampiesquirtinghmdnhmdn-411hmdn411328hmdn-411
    • 2021-09-30
    74 min

    533NNS-009 Outdoor Masturbation Love Pervert Saffle Big Tits Beauty And Fucking Squirting Sex Photo Session! !! Continuous Vaginal Cum Shot Ascension At The Woman On Top Posture! !!

  • amateur censoredcreampiebig titsnnsnns-009nns009533nns-009
    • 2021-10-29
    112 min

    [SHKD-975]I Have My Favorite Weather Girl Here At My Home, In Confinement, So I Can Have Creampie Sex With Her Every Day. Hikari Ninomiya

  • hikari ninomiya censoredcreampiesingle workSHKDattackerssada oka sadaoshi yoru akuSHKD-975SHKD975shkd00975



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi