jav ass fetish javcensored schoolgirl miniskirt




FC2STARSDTTNACRWAAAKBISANEBODNATRAUKSAMBIBLKSPRDMVSDPREDCESDMILKCAWDSSISSDABLULU

2024-04-06
120 min

SLAP-132 Provocation School Girls School Student School Girls Transparent Chair Panmolo Adhesion Panties 15

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-132SLAP132slap00132
    • 2024-02-24
    132 min

    SLAP-131 KIGAE Super Miniska School Girls

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-131SLAP131slap00131
    • 2024-01-13
    104 min

    SLAP-130 A Schoolgirl In A Super Miniskirt Shows Off Her Panties And Provokes Me. (SLAP-130)

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-130SLAP130slap00130
    • 2024-01-12
    120 min

    MIAB-085 I Can"t Stand My Childhood Friend"s Youthful Big Ass That Provokes Me In A Miniskirt, So I Immediately Go Crazy With The Back Piston! Ema Futaba Loves To Cum Inside A Convulsing Pussy That Leaks Climax

  • futaba emma censoredcreampieschoolgirlMIABmoody seighteveryone s kikatanMIAB-085MIAB085miab00085
    • 2023-12-23
    115 min

    SLAP-129 Panchira Co., Ltd. 24

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-129SLAP129slap00129
    • 2023-11-03
    120 min

    MIAB-013 Squat Preaching To A Miniskirt J-type Gal Who Violates School Rules! I Straddled Her On The Air Chair And Pressed My Erect Dick Against Her, Thrusting It Through The Cloth Of Her Pants, And Made Her Cum In Cowgirl Position! Amiri Saito

  • amiri saito censoredcreampieschoolgirlMIABmoody sviva gonzoeveryone s kikatanMIAB-013MIAB013miab00013
    • 2023-09-23
    95 min

    GROO-062 Groovin’ Stripdance Super Miniskirt Schoolgirl 4

  • censoredschoolgirlGROOdigital arcdigital arkGROO-062GROO062groo00062
    • 2023-08-19
    104 min

    SLAP-126 KIGAE Peeping On A Dirty Little Schoolgirl Who Changes Into A Super Miniskirt Uniform

  • censoredschoolgirlSLAPdigital arckashimadigital arkSLAP-126SLAP126slap00126
    • 2023-07-22
    120 min

    SLAP-125 Provocative School Girls Invisibility Transparent Chair Pan Moro Tight Panties 14

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-125SLAP125slap00125
    • 2023-06-24
    90 min

    SLAP-124 Prison14

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-124SLAP124slap00124
    • 2023-05-20
    94 min

    SLAP-123 Schoolgirls Show Their Panties Into Their Pussies 9

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-123SLAP123slap00123
    • 2023-05-06
    132 min

    KHIP-010 My Niece, Who Came To My House Due To Poor Behavior, Couldn'T Put Up With Momojiri Peeking Out Of Her J-Miniskirt, And When She Attacked Me, She Unexpectedly Honestly Made Me Do It And Creampied Every Day Since Then! Hiizumi Maika

  • maika hizumi censoredcreampieuniformKHIPprincess kaguya pt delusional familynortonkaguya hipKHIP-010KHIP010khip00010
    • 2023-05-06
    96 min

    SLAP-122 Super Miniskirt School Girls Puri Ass Panty Shot 5

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-122SLAP122slap00122
    • 2023-04-08
    125 min

    KHIP-009 My Niece, Who Came To My House Due To Poor Behavior, Couldn'T Put Up With Momojiri Peeking Out Of Her J-Miniskirt, And When She Attacked Me, She Unexpectedly Honestly Made Me Do It And Creampied Every Day Since Then! Takase Rina

  • rina takase censoredcreampieschoolgirlKHIPprincess kaguya pt delusional familynortonkaguya hipKHIP-009KHIP009khip00009
    • 2023-03-04
    128 min

    KHIP-008 My Niece, Who Came To My House Due To Poor Behavior, Couldn'T Put Up With Momojiri Peeking Out Of Her J-Miniskirt, And When She Attacked Me, She Unexpectedly Honestly Made Me Do It And Creampied Every Day Since Then! Yokomiya Nanami

  • yokomiya nanami censoredcreampieschoolgirlKHIPkaguya hime pt mousozokuno tonkaguya hipKHIP-008KHIP008khip00008
    • 2022-10-01
    129 min

    KHIP-004 When I Can'T Stand Momojiri Peeking Out Of My Niece J Series Miniskirt Who Decided To Come To My House Due To Bad Behavior, And When I Attacked, I Made Me Do It Surprisingly Obediently, And Since Then I Have Vaginal Cum Shot Every Day! Matsu

  • ichika matsumoto censoredcreampieschoolgirlKHIPkaguya hime pt mousozokuno tonkaguya hipKHIP-004KHIP004khip00004
    • 2022-08-06
    98 min

    SLAP-113 パンチラ株式会社22

  • censoredschoolgirlSLAPdigital ark dejitarua kudigital arkSLAP-113SLAP113slap00113
    • 2022-06-25
    95 min

    GROO-060 groovin’ 超ミニスカ女子校生 パンチラDISCO23

  • censoredschoolgirlGROOdigital arkdigital ark dejitarua kuGROO-060GROO060groo00060
    • 2022-01-29
    92 min

    [SLAP-106]KAIDAN 11

  • censoredschoolgirlSLAPdigital arkdigital ark dejitarua kuSLAP-106SLAP106slap00106
    • 2022-01-15
    91 min

    [SLAP-105]Super Mini Skirt S*********ls - Little Plump Butts Panty Shots 3

  • censoredschoolgirlSLAPdigital arkdigital ark digital arkSLAP-105SLAP105slap00105
    • 2021-12-24
    184 min

    [HUNTB-171]Glasses x Knee-High Socks x Miniskirt x Thong This Sch**lgirl Is So Excessively Erotic, She"s Giving Me A Full-On Hard On! "I Don"t Know If I Can Make You Feel Good, But I Can Do Some Sexy Things For You ..."

  • censoredschoolgirlHUNTBhuntermorikihhh groupHUNTB-171HUNTB171huntb00171
    • 2021-04-09
    145 min

    [SKMJ-158]Slip Your Dick Into This Big Ass Sch**lgirl From Behind For Some Quickie Action! This Beautiful Y********l In Uniform Works Part-Time At A Housecleaning Service And When She Came To Your House You Couldn't Resist The Temptation Of Her M

  • censoredcreampiebig titsSKMJred face girlswing nagaseSKMJ-158SKMJ158h-1324skmj00158
    • 2020-07-11
    116 min

    [MIDE-802]S********l In Uniform Goes Commando - So Close You Can Her Anal Hole In Full Yui Kawai

  • yui kawai censoredschoolgirlsisterMIDEmoodyzdragon nishikawamoodyz divaMIDE-802MIDE802mide00802
    • 2018-11-02
    135 min

    [HODV-21334]Full-Booty Panty Shot Show and the Total Domain Between Micro-Miniskirt and Knee-High Stockings The Tiniest, Cutest Classmate Kanon Momojiri

  • momojiri kanon censoredschoolgirlsingle workHODVh m pbottomsHODV-21334HODV2133441hodv021334
    • 2018-05-20
    125 min

    [ARM-677]Blowjob Girls Academy Bubble Butt Class

  • tomoe aragaki rena matsui censoredschoolgirlblowjobARMaroma planningaromaARM-677ARM677arm00677
    • 2018-05-11
    124 min

    [VRTM-349]When We Slipped Aphrodisiacs To A Panty Shot Schoolgirl Wearing A Hot Miniskirt, She Started To Grind Her Knee High Socks Against Us And Stained Her Panties And Locked Her Legs Around Us And Demanded Creampie Sex! 4

  • mitani akari aya miyazaki censoredcreampieschoolgirlVRTMv r producekoenji goroVRTM-349VRTM349h-910vrtm00349
    • 2017-12-07
    240 min

    [SW-524]My Classmate Has Some Juicy Looking Thighs, And When I Got A Peek Underneath Her Skirt, I Realized She Was Wearing A Thong! 2 A Schoolgirl In Knee High Socks And A Thong Is Breathing Sweet Nothings Into My Ears

  • censoredschoolgirlSWswitchraito fuji makotoSW-524SW5241sw00524
    • 2017-10-13
    172 min

    [VRTM-294]We Slipped Some Aphrodisiacs To A Panty Shot Flashing Schoolgirl In A Miniskirt, And She Started Rubbing Her Knee High Socks Together And Wet Her Panties, And Scissor Locked Us In Her Legs And Begged Us To Creampie Her! 3

  • miki aise rina minami censoredcreampieschoolgirlVRTMv r producetiger kosakaiVRTM-294VRTM294h-910vrtm00294
    • 2017-01-13
    198 min

    [VRTM-227]The Reason I Got Married Was Because I Wanted My Wife's Daughter! Her New Dad Is Giving This Inexperienced Young Girl A Sex Education! I Know She's Just A Schoolgirl, But I'm Breaking In This Innocent Babe With A Big Ass And Mak

  • asada yuri airi sato censoredcreampieschoolgirlVRTMv amp r produceyamanaka socksVRTM-227VRTM227h-910vrtm00227



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi