jav censored creampie javcensored cuckold ntr




FC2CJODSDABNNPJHNDSSISGVHHZGDNACRAUKSSPRDFSDSSSANSTARSDASDCHRVHDKAMVSDABWWANZAVSA

2020-11-18
51 min

FC2PPV 1574613 [Active Yoga Instructor] Breaking the Race Queen Glossy Pantyhose (Direct Wearing) and Sliding And Cum Shot In A Slimy Pussy! The costume that clings to the F cup body of the highleg mistress who bites in is the best fetishism!

  • amateur uncensoredfc2
    • 2020-11-22
    119 min

    [HND-907]A Great Woman To Fuck! A Genius Who Enjoys Sex Appears! Beautiful Ass Bitch Creampie AV Debut!! Ramu Murata

  • murata raimu censoredcreampiesingle workHNDhon nakamichiru arashiyamaHND-907HND907hnd00907
    • 2020-12-19
    65 min

    488MCV-003 OL is too carnivorous girl and sperm was exploited for 2 consecutive times

  • amateur censoredcreampieamateurmcvmcv-003mcv003488mcv-003
    • 2020-12-31
    120 min

    [NKKD-190]This Couple Dreamed Of Living In The Country... The Husband Never Imagined Hung Farmers Would Be Plowing His Wife Miho Tono

  • miho tsuno censoredmature womansingle workNKKDjet eizomanji groupNKKD-190NKKD190nkkd00190
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-16
    150 min

    [EKDV-653]Oiled Up Colossal Tits - Slick J-Cup Spread Wide With Ecstasy! Hana Himesaki

  • himesaki hana censoredcreampiebig titsEKDVcrystal eizokumataro morinoe kissEKDV-653EKDV65349ekdv00653
    • 2021-01-16
    122 min

    FC2PPV 1646786 [Creampie 2 barrage] If you get caught in the shop, the ban is confirmed! During life from Menes hidden shooting → Super rich sex of cleaning blowjob × 2

  • amateur uncensoredfc2
    • 2021-01-21
    240 min

    [SVDVD-838]Shame! A Newly Appointed Nurse Takes A Medical Examination Before Being Assigned To Her New Post 2021 We Were Experimented On By The Resident Doctors

  • ayaka mochizuki honoka wakamiya censoredcreampienurseSVDVDsadistic villageista girl and her shameSVDVD-838SVDVD8381svdvd00838
    • 2021-01-25
    57 min

    FC2PPV 1659409 [No] [Limited number of 2000pt OFF!] F cup beauty I met on the daddy activity app ❤️ Calling a friend while I was masturbating ❤️ It’s the best to be born ❤️ * Review privilege / second consecutive sex (59 minutes) and masturbatio

  • amateur uncensoredfc2
    • 2021-01-30
    149 min

    [MIDE-875]That Swimming Instructor Isn't Aware That She's Showing Off Her Big Tits, And It Really Pisses Us Off, So We All Got Together And G*******ged That Bitch Shoko Takahashi

  • shoko takahashi censoredbig titssingle workMIDEmoodyzmametaro mamezawamoodyz divaMIDE-875MIDE875mide00875
    • 2021-01-31
    14 min

    FC2PPV 1666678 (Limited time) Selfie neighborhood_a01_former underground idol_raw Gonzo

  • amateur uncensoredfc2
    • 2021-03-05
    53 min

    FC2PPV 1712668 ★ First shot premiere amateur ☆ Miraculous nice body ♥ G cup god milk ♥ Ancient capital of erotic big ass 22 years old ☆ This one rare video ♥ Super erotic body is sensitive immediately ♥ Excitement can not be suppressed and vaginal cu

  • amateur uncensoredfc2
    • 2021-03-13
    156 min

    [MIDE-896]They'll Still Give You Nookie Even After You Ejaculate At This Gentle And Softly Whispering Rejuvenating Massage Parlor Rikka Ono

  • rokka ono censoredcreampieblowjobMIDEmoodyzhirokoji osakimoodyz divaMIDE-896MIDE896mide00896
    • 2021-03-18
    237 min

    [PPPD-912]Big Titty Master Girls With Big Tits Introduce Us One By One To Girls With Even Bigger Tits!

  • censoredcreampiebig titsPPPDoppaiPPPD-912PPPD912pppd00912
    • 2021-03-20
    31 min

    FC2PPV 1734831 [Discontinued] Deldermisuko [Tall 170cm lady]

  • amateur uncensoredfc2
    • 2021-03-23
    61 min

    1Pondo 032321_001 Seducing by Flashing Pussy: Mikako Tachibana

  • amateur uncensored1pondo
    • 2021-04-18
    126 min

    [APNS-238]Stepsister Swap - How To Wreck A Family Mitsuha Higuchi Sumire Kurokawa

  • mitsuha higuchi sumire kurokawa censoredcreampiedramaAPNSaurora project annexyukihiro nasuaurora project anexAPNS-238APNS238apns00238
    • 2021-04-22
    120 min

    [FSDSS-212]Double S*sta NTR This Newlywed Wife's Step-Nephews Are Cumming At Her With A Double Prank Combination Massage Until They Successfully Fuck Her To Orgasmic Ecstasy Tina Nanami

  • nanami tina censoredsingle workFSDSSfalenokaorufaleno starFSDSS-212FSDSS2121fsdss00212
    • 2021-04-24
    113 min

    FC2PPV 1784480 Celebration! Half price for the first anniversary thank-you project! [No individual shooting, art 〇 world debut! The 4th miracle super beautiful girl leaked a hidden shot! ] Private SEX 2nd round that can only be seen here! It will be

  • amateur uncensoredfc2
    • 2021-05-08
    184 min

    [SQIS-050]Uniform Porn Braids / White Panties / Ribbons / Black Stockings

  • censoredschoolgirldramaSQISfa proSQIS-050SQIS050sqis00050
    • 2021-05-25
    65 min

    499NDH-019 An advancing addict who eats a man with his upper and lower mouths! This cowgirl won a great grand prize! !! Belochu LOVE carnivorous demon sexual desire is attacked and behaves in a big way! I thought that I was chin-pressed, but immediat

  • amateur censoredsquirtingamateurndhndh-019ndh019499ndh-019
    • 2021-06-03

    FC2PPV 1851396 [Individual shooting 40] Complete appearance 18-year-old pie bread J 〇 Creampie to Miss Refre

  • amateur uncensoredfc2
    • 2021-06-08
    57 min

    HEYZO 2544 Flat-chested Girl In School Uniform Gets Multiple Cream Pies – Amu Mashiro

  • amu mashiro uncensoredcreampiehandjobheyzo
    • 2021-06-11
    126 min

    [BANK-042]A Coed Gal Hot Spring Resort Good Time A Super Beautiful Gal! These Aren't Fake Titties, These Are The Real Thing, Shaped Like Bowls, And Attached To A Genuinely Slutty And Horny Gal Chisato Morisaki

  • tomomi morisaki censoredanalcreampieBANKpussy banktake chanBANK-042BANK042h-1495bank00042
    • 2021-06-19
    119 min

    [CAWD-232]Her 19-Year-Old Body's Still Developing - Ririi Sena - 2-Orgasm Special

  • lily sena censoredsquirtingbeautiful girlCAWDkawaiitake dCAWD-232CAWD232cawd00232
    • 2021-07-03
    64 min

    SIRO-4508 [First shot] [Small animal carnivorous gal] [Marshmallow butt that seems to be squirming] Heavyweight libido hidden in the minimum class body. The finest white gal who felt unsatisfactory with her boyfriend and saffle fully released her sex

  • amateur censoredamateursirosiro-4508siro4508siro-4508
    • 2021-07-03
    60 min

    418YSS-85 Tsubasa

  • amateur censoredbig titsamateuryssyss-85yss85418yss-85
    • 2021-07-09
    150 min

    [IPIT-019]A Healing Beauty Who Is a Top Pick at a Members-Only Lounge Where Ordinary People Are Not Allowed: A Mountaintop Flower Beyond Our Reach. Hitomi Hoshitani's AV Debut

  • hitomi hoshitani censoredblowjobsingle workIPITidea pocketmichiru arashiyamaideapocket talent discovery projectIPIT-019IPIT019ipit00019
    • 2021-07-16
    86 min

    [FTHT-018](Rough Sex! Strung Up Upside-Down For A Blowjob! Pussy-Licking! A Sixty-Nine!) Get Ready To Blow Your Load Over This Totally Outrageous Position! Merciless Booty Spanking! Ass Cheeks Flushed Bright Red! Moaning In Delight! "You Can'

  • censoredcreampiemarried womanFTHTfalenodavielfalenotubeFTHT-018FTHT0181ftht00018
    • 2021-07-17
    145 min

    [CAWD-243]I Wasn't Sure if She'd be Able to do it the First Time, but I Creampied Her Again and Again, Practicing my Fucking on her with Animal Desire. Mayuki Ito.

  • maiyuki ito censoredcreampiesingle workCAWDkawaiibungo maedaCAWD-243CAWD243cawd00243
    • 2021-07-22
    240 min

    [CLUB-646]Rejuvenating Happy Ending Massage Of A Married Woman 29 - Creampie Negotiation Voyeur

  • censoredcreampiemarried womanCLUBhentai gentleman clubCLUB-646CLUB646club00646
    • 2021-08-03
    141 min

    [KUSE-019]Woman Has A Bad Habit Tempting With Her Holes When She Wants It! Thick Bitch In Hole Temptation Reverse Pick Up Everywhere, Jun Asami

  • asami jun censoredbig titssoloworkKUSEsod createsandmanjoyuu no kuse ga sugoiKUSE-019KUSE019
    • 2021-09-01
    75 min

    444KING-045 Yuzu

  • amateur censoredcreampiesquirtingkingking-045king045444king-045
    • 2021-09-03
    118 min

    [MIAA-495]Bored Of Sex With My Wife So I Got A Mistress-Reverse Work-at-home NTR Luna Tsukino

  • tsukino luna censoredcreampieslutMIAAmoodyzgoemonminna no kikatanMIAA-495MIAA495miaa00495
    • 2021-09-10
    136 min

    [JUL-695]NGR - Swept Away - The Bride Learned What True Pleasure Was For The First Time In Her Life When She Got Fucked By Her Big Brother-In-Law Ryo Ayumi

  • ayumi ryo censoredmature womansingle workJULmadonnajotaro tomiJUL-695JUL695jul00695
    • 2021-10-03
    16 min

    FC2PPV 2288831 ≪Enkou Hidden Camera 23≫ Beauty Influencer / In-Car Blowjob Mouth Shot (2 Turtles)

  • amateur uncensoredfc2
    • 2021-10-07
    181 min

    [SHIND-018]A Relentless Stalker Goes Hunting For Maso Bitches On The Train A Home Invasion Record #34 35

  • censoredamateurSHINDshinkirousuzuki o maSHIND-018SHIND018h-1560shind00018
    • 2021-10-29
    56 min

    530DG-028 Internet Cafe ○ Sleep ○ P Record Of Store Manager Who Repeated Sexual Crimes ＃ 04

  • amateur censoredcreampieamateurdgdg-028dg028530dg-028
    • 2021-10-30
    67 min

    C0930 tk0045 Aoi Katsuse 28years old

  • amateur uncensoredc0930
    • 2021-11-21
    32 min

    FC2PPV 2452189 Until 28 3980 [Face Exposure] Cheeky Black-Haired Beautiful Girl. She Is Unlicensed 10 Consecutive Vaginal Cum Shot To A Woman Who Dislikes Being Brought To The Hotel. 10 Consecutive Blowjobs Are Distributed By Scoring.

  • amateur uncensoredfc2
    • 2021-11-25
    92 min

    [OKB-124]Maika Hiizumi - Curvy Big Ass, Barely Legal Beautiful Girl In Gym Shorts, Chubby Girl Busting Out Of Her Gym Shorts, Putting On Gym Uniforms, Underwear Sticking Out, See Super Close-up Pussy Shots That Practically Show Every Little Pore! Ass

  • maika hizumi censoredsingle workbukkakeOKBoyaji no kosatsukami bloomersOKB-124OKB1241okb00124
    • 2021-12-03
    147 min

    [CAWD-304]All She Thinks About Is Sex! Out-Of-Control Fucking x 2 Fucks For A Cumtastic 3-Fuck First Experiences For Arisu Kusunoki, Who Is Hooked On All This Fucking Action

  • kusunoki arisu censoredbeautiful girlsingle workCAWDkawaiinikusonCAWD-304CAWD304cawd00304
    • 2021-12-04
    121 min

    [BAHP-096]AV Debut! Nursery Teacher Who Cannot Reveal Face. Can Appear With Mask! When She Undresses Has Well Proportioned Body And Loves Lewd Sex.

  • censoredbig titsamateurBAHPbaltanyosukehoppinBAHP-096BAHP096bahp00096
    • 2021-12-07
    68 min

    494SIKA-130 Sex Rolled Up With Aphrodisiac And Alcohol

  • amateur censoredamateursikasika-130sika130494sika-130
    • 2021-12-10
    149 min

    [XRLE-024]Turned Tattoo Gal Bitch College Girls Into Meat Urinal By Cumming All Over It Until I Got Bored. Miyu Oka

  • miyu sakuraka censoredcreampieschoolgirlXRLEreal workssuginokireal real worksXRLE-024XRLE024xrle00024
    • 2021-12-10
    181 min

    [IPIT-022]I Just Wanted To Squirt... Av Debut Of A Beautiful Girl With Beautiful Snow-white Skin Who Blows Too Much! Mei Uesaka

  • mei uesaka censoredsquirtingblowjobIPITidea pocketusa pyonideapocket talent discovery projectIPIT-022IPIT022ipit00022
    • 2021-12-19
    56 min

    229SCUTE-1166 Mitsuha (24) S-Cute Twintail Uniform Sex (Mitsuha Higuchi)

  • amateur censoreduniformamateurscutescute-1166scute1166229scute-1166
    • 2021-12-23
    61 min

    1Pondo 122321_001 Naughty Kiss And Fucking: Asuka Motomiya

  • amateur uncensored1pondo
    • 2021-12-31
    126 min

    [RBK-034]A Showroom Of Sluts. Anal Sex For The Deceived New Wife. Moe Hazuki

  • moe hazuki censoredanalsingle workRBKattackerskaoru okuzonoryupakuRBK-034RBK034rbk00034
    • 2022-01-06
    93 min

    484LULU-045 The First Creampie For A Papa Katsu Gal Who Loves Fathers! Even Licking With A Threatening Split Tongue! At The End, The Photographer Also Made A Vaginal Cum Shot To The Spear Man Gal!

  • amateur censoredcreampieamateurlulululu-045lulu045484lulu-045
    • 2022-01-15
    61 min

    H4610 ori1771 Chiaki Komiyama 21years old

  • amateur uncensoredh4610
    • 2022-01-19
    86 min

    476MLA-064 [Big Breasts I Cup] A Pachinko Clerk With The Strongest Boobs In The Area Is Here! !! Knead, Suck, Pinch! !! "Boobs Burun! Burun!" Do Powerful Breast Shaking Sex (Mikuru Arioka)

  • amateur censoredcreampiebig titsmlamla-064mla064476mla-064
    • 2022-02-11
    149 min

    [MEYD-738]10,000 Social Media Followers! Hookup Over The Internet! You Can Meet Her Immediately If You Book A Reservation! There"s Nothing She Won"t Do And She"s A Cum Swallowing Angel! A Currently Active Yoshiwara Soapland Princess Makes

  • censoredsquirtingblowjobMEYDtameike gorotake dMEYD-738MEYD738meyd00738
    • 2022-02-11
    150 min

    [MIDV-052]Ban Lifted! H-Cup Fumika Nakayama"s First Creampie Fuck

  • nakayama fumika censoredcreampiebig titsMIDVmoodyzusa pyonmoodyz divaMIDV-052MIDV052midv00052
    • 2022-02-12
    118 min

    [OMHD-015]＜超極限・近親相姦映像＞生まれてこの方、父親しか知らない性玩具の名は、牢獄（ハコ）入り娘。 工藤ララ

  • lara kudo censoredsingle workOMHDdogmamigiwa otaOMHD-015OMHD015omhd00015
    • 2022-02-12
    239 min

    [TIKB-132][Amazing Gal Hall Of Fame] Gals Really Are The Best! vol. 5

  • censoredcreampiebig titsTIKBtikitiki.comerTIKB-132TIKB132tikb00132



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi