jav female college student javcensored high vision incest




FC2FSDSSBLKONEZATIDADNAWDAPODSPRDSDABGVHMIDVCAWDMEYDMVSDHMNDASDSHKDHDKAHZGDWAAA

2021-01-01
63 min

SIRO-4381 [First shot] [20 years old x G cup x beautiful breasts] [Erotic body that looks delicious] A professional student who panting obscenely while shaking G milk. Don’t miss the service of licking with a cute face! AV application on the net

  • amateur censoredbig titsamateursirosiro-4381siro4381siro-4381
    • 2021-01-15
    47 min

    FC2PPV 1645865 [Personal shooting] Ginza club mom raises funds to protect the store Enko! Raw insertion cum shot in glamorous big ass

  • amateur uncensoredfc2
    • 2021-01-16
    145 min

    [SSNI-963]The Top Sex Cosplayer In Japan - Yua Mikami

  • yua mikami censoredbig titscosplaySSNIs1 no 1 styletake dSSNI-963SSNI963ssni00963
    • 2021-02-05
    115 min

    [PARATHD-3108](Emergency Broadcast) Hot Girls Are Pissing Themselves Live - Embarrassing Drenched Panties - Complete Edition

  • hebei haruna moe hazuki censoredPARATHDparadise tvPARATHD-3108PARATHD3108parathd03108
    • 2021-02-13
    119 min

    240TOKYO-411 Sayaka

  • amateur censoredanalbig titstokyotokyo-411tokyo411240tokyo-411
    • 2021-02-18
    178 min

    [SSNI-995]Hiyori Yoshioka's S1 Graduation - Starting With Her Final Trip To The Hot Springs (Uned! All POV! Plus No Makeup？!) Real Horny Instinctive Naughty SEX! Refreshing, Raw, Graphic, Ultra Rare 200 Erotic Private Fucks Finally Made Public

  • hiyori yoshioka censoredbeautiful girlsingle workSSNIs1 no 1 styleSSNI-995SSNI995ssni00995
    • 2021-02-18
    53 min

    [GRMR-034]スローセックスに溶かされて

  • mihina azumihina mihina nagai hiroomi nagase censoredGRMRmura chleo hakusanGRMR-034GRMR034h-1534grmr00034
    • 2021-02-25
    64 min

    [orec-704]とうか

  • amateur censoredcreampiebig titsorecorec-704orec704orec-704
    • 2021-03-05
    115 min

    [PARATHD-3128][Emergency Live Broadcast] Welcome To The Pussy Hair Photo Studio! Full Version

  • yuuri anne mashiro censoredamateurPARATHDparadise tvPARATHD-3128PARATHD3128parathd03128
    • 2021-03-05
    87 min

    [ZOZO-056]The New Female Teacher: Saya Sakura Tsukishima's Shame! Sexual Education At An All-boys' School

  • censoredcreampiebig titsZOZOsadie willenauZOZO-056ZOZO0561zozo00056
    • 2021-03-06
    62 min

    Caribbeancom 030621-001 Beautiful Bride – Creampie SEX on the eve of the wedding with the staff Miyuki Sakura

  • miyuki sakura uncensoredcreampiehandjobcaribbeancom
    • 2021-03-11
    127 min

    [GUN-850]Eri Akira Bites And Fucks

  • aki erie arai erie yuka osawa censoredsingle workGUNradixkikurinexceptionalGUN-850GUN850433gun00850
    • 2021-03-15
    238 min

    [WA-451]12 Married Woman Babes! Peeping On Aphrodisiac-Laced Squirting Orgasmic Masturbation

  • censoredsquirtingWAlotusWA-451WA451h-047wa00451
    • 2021-03-20
    48 min

    H0930 ori1596 Yuriko Otomi 36years old

  • amateur uncensoredh0930
    • 2021-03-30
    55 min

    H0930 ki210330 Yumiko Imai 24years old

  • amateur uncensoredh0930
    • 2021-04-06
    90 min

    FC2PPV 1757093 Nice to meet you, Ladygra administration ♥ ️ Kime ☆ SEK class! An erotic girl who is too young hides her face and does not hide her pussy [Personal shooting]

  • amateur uncensoredfc2
    • 2021-04-09
    140 min

    [EBOD-814]Only 20 Years Old! The No. 1 Hostess In Ginza! Her Porn Debut Mina Kitano

  • mina kitano censoredbig titssingle workEBODe bodyhirokoji osakiEBOD-814EBOD814ebod00814
    • 2021-04-09
    159 min

    [MDBK-172]She Won't Stop Even If You Blow Your Load - Endless Nipple Teasing As The Nipple Specialist Call Girl - Plus Cowgirl Creampie Option

  • natsuho imai yano tsubasa censoredbig titsslutMDBKbazookaMDBK-172MDBK172mdbk00172
    • 2021-04-12
    65 min

    SIRO-4446 [First shot] [Beautiful apparel clerk] [Careful smile of semen bettori] An apparel clerk with snow-white skin appears. She is an adult-like girl with a calm behavior, but when her sensitive parts are stimulated, she begins to writhe in a cu

  • amateur censoredamateursirosiro-4446siro4446siro-4446
    • 2021-04-22
    115 min

    [CHERD-075]"Would You Mind Your First Time Being Raw Sex With An Older Woman？" Virgin Pops His Cherry In The Best Way With A Hot Married Cougar Yumie Kashihara

  • tomie kashihara censoredcreampiemature womanCHERDcenter villagejiro fukagawahanazono center villageCHERD-075CHERD075h-086cherd00075
    • 2021-04-23
    238 min

    [BMW-232]My Stepsister Seduced Me While Our Parents Weren't Paying Attention - Pulse-Pounding Creampie BEST Collection

  • mitani akari real village henan censoredcreampieblowjobBMWwanz factorywanzBMW-232BMW232bmw00232
    • 2021-04-27
    102 min

    261ARA-486 [Nutrition (SEX) deficiency] 30 years old [Big tits and fair body] Yumina is here! She is a registered dietitian at the hospital. The reason for her application is "High protein. I want to have a high calorie etch …" She says

  • amateur censoredbig titsamateuraraara-486ara486261ara-486
    • 2021-05-01
    118 min

    [JUL-569]"When You Look At Me With Such Moist, Sexy Eyes, You Make Me Want To Fuck You." I Was Always Infatuated With This Beautiful Married Woman, And She Begged Me For Help As She Was Being Fucked, And I Got So Excited Watching Her Get Bang

  • hojo asahi censoredcreampiemature womanJULmadonnamametaro mamezawaJUL-569JUL569jul00569
    • 2021-05-15
    125 min

    [MOPT-007]The Best Prostitute, Who Turns Masochistic Men Crazy By Bringing Them To The Edge Of Climax And Then Repeatedly Making THem Pull Out - Ameri Hoshi

  • star ameri censoredanalslutMOPTm o paradisemo tightMOPT-007MOPT007mopt00007
    • 2021-05-16
    239 min

    [MXSPS-664]REQUEST Small Waist Beautiful Girl Nono Mizusawa

  • mizusawa nono censoredbeautiful girlsingle workMXSPSmaxingMXSPS-664MXSPS664h-068mxsps00664
    • 2021-05-21
    69 min

    491TKWA-173 SEX I-Cup Big Breasts Enko J ● I Just Learned Allows Creampie By Rolling Up Continuously!

  • amateur censoredcreampiebig titstkwatkwa-173tkwa173491tkwa-173
    • 2021-06-01
    69 min

    H0930 ki210601 Miki Ide 30years old

  • amateur uncensoredh0930
    • 2021-06-02
    48 min

    FC2PPV 1848004 [Big orgy with a beautiful girl warrior] 6P instead of the moon! Punishment of virgin kun’s cock in a dream situation, multiple blowjobs, raw squirrel, vaginal cum shot, Anikos harem

  • amateur uncensoredfc2
    • 2021-06-04
    119 min

    [JUL-605]On The Seventh Day Of Being Ravished By My Husband's Boss, I Lost All Sense Of Reason... Ayaka Muto

  • ayaka muto censoredmature womansingle workJULmadonnatakeshi kogaJUL-605JUL605jul00605
    • 2021-06-11
    119 min

    [EBOD-832]Experienced Stepsister Breaks In Her Virgin Older Stepbrother! First She Flirts With Flashes Of Cleavage -> The Temptation Is Too Much And His Rock Hard Cock Is Ready To Ride Her All The Way To A Creampie! Ami Yozora

  • ami yozora censoredcreampiebig titsEBODe bodytrendy yamaguchiEBOD-832EBOD832ebod00832
    • 2021-06-15
    58 min

    FC2PPV 1870587 ★ First shot amateur ☆ Perverted beauty with a desire to be fucked by vaginal cum shot ♥ Ayana-chan 24 years old ☆ Shaved Moriman ♥ Best blowjob ♥ Lustful raw squirrel ♥ Creampie prepared for pregnancy ♥ [Individual shooting] Benefits

  • amateur uncensoredfc2
    • 2021-06-16
    247 min

    [DVDMS-672]A Normal Boys And Girls Focus Group Adult Video These Male And Female Colleagues Are Locked In A Room And They Won't Be Let Out Until They Can Produce 20ml Of Semen! In Order To Get Their Male Colleagues To Cum, These Female Employees

  • censoredcreampiebig titsDVDMSdeep ssuttorune iwanagaDVDMS-672DVDMS672dvdms00672
    • 2021-06-26
    241 min

    [SGSR-280]The Amateurs On The Street Panty Shot Channel They Said, "Don't You Dare Look!" But These Secretly Horny Gal Babes Came Anyway! 4 Hours 20 Girls

  • censoredamateurSGSRbig morkaleigyochuushinsengumiSGSR-280SGSR28057sgsr00280
    • 2021-06-29
    61 min

    Caribbeancom 062921-001 Thanks Fans festival: Haru Aizawa

  • haru aizawa uncensoredcreampiehandjobcaribbeancom
    • 2021-07-08
    179 min

    [FSDSS-252]The Weekend My Girlfriend Was Away, I Titty-Fucked Her "Friend" And Drenched Her In Cum Moe Amatsuka

  • angel moe censoredbeautiful girlslutFSDSSfalenomaeda ichimonfaleno starFSDSS-252FSDSS2521fsdss00252
    • 2021-07-09
    162 min

    [IPX-686]In a Room on a Business Trip, Fresh Face Female Employee is Fucked Several Times All Night Long by a Superior Boss. Aroused to Come 8 Times, an Unequaled Cockold Sex Video. Ema Futaba

  • futaba emma censoredbig titsblowjobIPXidea pocketbungo maedadishIPX-686IPX686ipx00686
    • 2021-07-21
    37 min

    FC2PPV 1934313 Infiltrate A Secret Orgy ㉞ Perfect Hips ♥ Beautiful Ass Is Crowded With More Aggressive Ossans Than Usual! 5 Thick Sperms Dripping From The Nice Ass ♪ * High Quality Version & Review Benefits Included ★

  • amateur uncensoredfc2
    • 2021-07-22
    118 min

    [CLUB-649]Start To Finish Video Of Fucking My Female Boss Raw Over And Over All Night After Accidentally Being Put In The Same Hotel Room As Her 2

  • censoredcreampieCLUBhentai shinshi clubCLUB-649CLUB649club00649
    • 2021-07-23
    160 min

    [LULU-087]My Colleague At My Part-Time Job Is A Big Tits Single Mother Who Let Me Stay At Her Place After I Missed The Last Train Home, And We Were Hanging Out, But She Was Unable To Hide How Horny She Was, So We Had Creampie Sex Until The Break Of D

  • ayaka muto censoredcreampiebig titsLULUlunaticsluminaxLULU-087LULU087lulu00087
    • 2021-08-06
    64 min

    10musume 080621_01 I’M Embarrassed But I Feel Good: If You Touch My Body So Much, I’Ll Get Wet! Ryoko Kobayashi

  • amateur uncensored10musume
    • 2021-08-12
    58 min

    FCP-034 [Delivery Only] Instead Of Angry Waves, Double Facial Cumshots! !! The Limit To Squeeze Until Empty!

  • amateur censoredamateurslutfcpfcp-034fcp034fcp-034
    • 2021-08-28
    145 min

    [JKSR-506]10 A.M.: What About School...Suzu - Suzu Monami

  • monami bell censoredcreampieschoolgirlJKSRbigmorkalobockeypinkjunkyJKSR-506JKSR50657jksr00506
    • 2021-09-09
    102 min

    FC2PPV 2181690 [9980 → 9/11 2980] [Complete Appearance] 22-Year-Old G Cup Neat Lady Nursing Student ❤️ I Really Had Such A Daughter ❤️ Real Erotic Cartoon Girl Without Acting ❤️ The World’S Best Ahegao ❤️ Whole Body Continuous Acme Cum Shot ❤️

  • amateur uncensoredfc2
    • 2021-09-10
    161 min

    [BANK-052]Busty Wife Hot Spring Date. Gentle Slow Paced Genuine Married Woman. J-cup Akane, 28 Years Old.

  • censoredcreampiebig titsBANKma ko ginkoutakechanBANK-052BANK052h-1495bank00052
    • 2021-09-17
    156 min

    [MIFD-180]She Loves Pizza! She Loves Sex! An AV Debut That Allows Her To Do Everything She Loves! Nanami Shiozaki

  • nanami shiozaki censoredblowjobbeautiful girlMIFDmoodyzkubo stylemoodyz freshMIFD-180MIFD180mifd00180
    • 2021-09-26
    115 min

    [083PPP-2243]「私、弟と一線を超えてしまいました」タブーを犯した義姉7人の近●相姦

  • amateur censoredbig titsamateurpppppp-2243ppp2243083ppp-2243
    • 2021-09-29
    46 min

    481SACZ-063 Yuko 5

  • amateur censoredamateurbdsmsaczsacz-063sacz063481sacz-063
    • 2021-10-08
    70 min

    393OTIM-092 [Delusional Subjectivity] Ovulation Day Child Making Service Maid Hinata Rina

  • amateur censoredcreampieamateurotimotim-092otim092393otim-092
    • 2021-10-15
    90 min

    [VENX-083]Creampie Life With My Mother-in-law Who I Have Been Longing For During Father"s Absence On An Employee Trip Asaka Tomita

  • asaka tomita censoredcreampiemature womanVENXvenuskanieincest vi nasuVENX-083VENX083venx00083
    • 2021-11-01
    123 min

    [HDKA-245]Nude Housekeeper Fully Naked Housekeeper Introduction Service Iori Natsune

  • natsune iori censoredcreampiebig titsHDKAplanet plusdirector orafu shukouHDKA-245HDKA245h-237hdka00245
    • 2021-11-06
    174 min

    [SUPA-598]First Time Shots For An S-class Super Bitch Amateur

  • censoredcreampieamateurSUPAs kyuu shiroutoSUPA-598SUPA598supa00598
    • 2021-11-28
    79 min

    FC2PPV 2470979 [Individual Shooting 63] Two People’S Appearance 20-Year-Old Streak Pie Bread And Uniform 3p Cleaning Fellatio After Re-Injection Many Times From Continuous Vaginal Cum Shot

  • amateur uncensoredfc2
    • 2021-12-03
    158 min

    [JUNY-053]Discovered A Plain Colleague Is A Call Girl...When Undresssed She Is Care Nurse With Huge Tits Ready For Raw Fuck Implantation Breaking In. Wareo Fujisawa

  • reo fujisawa censoredcreampiebig titsJUNYfitchnikuyokuJUNY-053JUNY053juny00053
    • 2022-01-14
    150 min

    [MVSD-494]Trashy Low Class Step-parent And Step-son Turn An Upper Class Married Woman Into Their Personal Slut. Seeing This Lovable Milf Get Fucked Non-stop Without Any Sense Of Modesty Right In Front Of Me. Megu Mio

  • mio meg censoredcreampiesingle workMVSDm s video groupbungo maedaMVSD-494MVSD494mvsd00494
    • 2022-01-21
    213 min

    [HUNTB-192]"You Said I Can Put It In Your Mouth？" My Stepmom Is Worried About Me When I"m Feeling Down For Premature Ejaculation Issues, So She Gives Me A Handjob And Blowjob To Help Train Me Not To Cum Too Fast! Her Mouth...

  • censoredcreampieblowjobHUNTBhunterkoichi davidsonhhh groupHUNTB-192HUNTB192huntb00192
    • 2022-02-04
    206 min

    [HUNTB-198]Immediately Fucking Just 30 Seconds After I Get Home! My Home Is A Gathering Place For S*****ts With Issues, So I Fuck Each Of My S*****ts In A Row! Creampie Loads All Around! As A Teacher...

  • censoredcreampieschoolgirlHUNTBhunterkawajirihhh groupHUNTB-198HUNTB198huntb00198



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi