jav high vision female college student javcensored creampie




FC2NNPJAUKSAPODHZGDAMBIVEMAROYDSHKDMEYDAVSACESDFSDSSWAAAADNJUFEAWDVENUPPPDNGODHODV

2020-06-14
242 min

[DVDMS-552]A Normal Boys And Girls Focus Group Adult Video A Thorough Investigation Of The Lust Life Of An Amateur College S*****t If You Can Resist Having Sex Until Morning, You Win 100,000 Yen! When These Male And Female Friends Missed Their Last T

  • censoredcreampieamateurDVDMSdeep sgreenhouse effectDVDMS-552DVDMS552dvdms00552
    • 2020-06-12
    161 min

    [MDBK-109]I Became The Manager Of A Share House Filled With Nothing But Seriously Cute College Girl Babes I'm The House Manager And These College Girl Babes Have Nothing But Serious Issues And They Kept Asking Me To Do Tedious Shit, Everything Fr

  • aoi kururugi kato momoka censoredcreampieMDBKbazookakuwattiMDBK-109MDBK109h-1496mdbk00109
    • 2020-06-12
    168 min

    [XRW-884]Big Titted College Girl Aphrodisiac, Tied Up Squirting And Made To Cum: Sachiko

  • sachiko censoredcreampiebig titsXRWreal worksani nakamurareal real worksXRW-884XRW884172xrw00884
    • 2020-06-12
    237 min

    [SABA-629]A Big Ass College Girl Is Having Her First Raw Hot Dogging Experience! She's Rubbing Up Against An 18cm Cock And Getting Her Pussy Dripping Wet As She Backs Her Ass Into Him And Then Suddenly He Enters Her Raw! Even After She Spasms And

  • censoredcreampieamateurSABAskyu shirotoone topSABA-629SABA629h-244saba00629
    • 2020-06-11
    150 min

    [JUFE-184]This Innocent College Girl With H-Cup Titties Wants To Be A Grown Up She's Spasming So Hard She's Losing Her Mind During Deep And Rich Abnormal Creampie Sex With A Dirty Old Man Ayase Tsuyuri

  • ayase russian pear censoredcreampiebig titsJUFEskyu shirotomichiru arashiyamafitchJUFE-184JUFE184jufe00184
    • 2020-06-09
    125 min

    [KTRA-224]Video Of A Girl Who Hides Her Big Tits Gets Fucked And Becomes A Woman Nagi Aiiro

  • indigo nagi censoredcreampiebig titsKTRAk tribeKTRA-224KTRA224h-094ktra00224
    • 2020-06-06
    129 min

    [NGOD-128]OB Visit Cheating, Yuria Yoshine

  • yoshine yuria censoredcreampiesingle workNGODjet eizomanji groupNGOD-128NGOD128ngod00128
    • 2020-06-06
    175 min

    [HUNTA-785]My Little Stepsister Was Wearing A Knitted One Piece Dress And Knee-High Socks, And Thrusting Out Her Ass, And I Could No Longer Resist, So I Plunged My Cock Into Her And After Creampie Fucking Her, Over And Over...!？ 2 Once She Became A C

  • censoredcreampiesisterHUNTAhuntercognac kaminohhh groupHUNTA-785HUNTA785hunta00785
    • 2020-05-29
    233 min

    [SKMJ-103]Country College Girl Babes Who Have Just Arrived In Tokyo Only! Would You Like To Experience Your First Slick And Slippery Pussy Grind Experience？ When His Rubberless Cock And Her Raw Pussy Collide, Their Privates Become Drenched In Bodily

  • censoredcreampieamateurSKMJred face girlone topSKMJ-103SKMJ103h-1324skmj00103
    • 2020-05-16
    161 min

    [DVDMS-543]This College Girl Is Living Alone, Prancing Around In Black Pantyhose, And I Couldn't Resist, So I Pumped My Big Cock Into Her From Behind For A Quickie! Then I Grabbed Her Ankles And Thrust Deep Into Her Pussy For Piston-Pounding Sex!

  • censoredcreampieamateurDVDMSdeep sswing nagaseDVDMS-543DVDMS543dvdms00543
    • 2020-05-16
    115 min

    [ROYD-006]Usually My Little Stepsister Is A Cute Plain Jane With A Big Ass, But Then She Started Showing Off The Total Domain Of Her Pussy, And By The Time I Realized What Was Happening, I Had Creampie Fucked her. Akari Neo

  • akari neo censoredcreampiebeautiful girlROYDroyalcognac kaminohhh groupROYD-006ROYD006royd00006
    • 2020-05-15
    223 min

    [MDTM-636]Creampie Raw Footage Of A Loose But Highly Educated College Girl Who Is Hunting For Sugar Daddies To Fulfill Her Lust

  • censoredcreampiebeautiful girlMDTMuchu kikakutetMDTM-636MDTM636h-585mdtm00636
    • 2020-05-10
    131 min

    [KIMU-005]The True Horny Identity Of A Sweet Girl In A Ponytail This College Girl Is So Shy She Can't Even Talk To Boys, But When She Has Sex She Fully Opens Up And Transforms Into A Horny Slut Who Demands Dirty Talk And Creampie Sex... Kotone To

  • toua kotone censoredcreampiebeautiful girlKIMUavs collector shiroyukifresh babe avs collectorKIMU-005KIMU005kimu00005
    • 2020-05-09
    403 min

    [KRU-086]Fantastical Daydream Theater - Your Dreams Come True! "Time Control Powers, Activate!" What If You Could Control Time？ I Manipulated Time to Fuck the Hot College Girl Interviewee! Get Ready for a Creampie Extravaganza!

  • censoredcreampiebig titsKRUkarmamanji groupKRU-086KRU086kru00086
    • 2020-05-03
    241 min

    [MMB-301]Diary Of A Popular Girl On Her Step Dad's Activities

  • ichijo mio scooping censoredcreampieschoolgirlMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-301MMB301mmb00301
    • 2020-05-02
    242 min

    [DVDMS-535]A Normal Boys And Girls Focus Group Adult Video Amateur College GIrl Babes Only! Will This College S*****t Without A Lover Fall In Love With A Man She Just Met After Just One Kiss, And Then Have Sex With Him？ These Two Are Totally Attracte

  • censoredcreampieamateurDVDMSdeep sgreenhouse effectDVDMS-535DVDMS535dvdms00535
    • 2020-05-02
    222 min

    [DVDMS-532]Faces Revealed On The Magic Mirror Number Bus College Girl Babes Only The Magic Mirror Number Bus Double-Date College S*****t Couple Swapping Variety Special! A Piston-Pounding Consecutive Ejaculation Cowgirl Battle! These Girls Are Engagi

  • censoredcreampieamateurDVDMSdeep sDVDMS-532DVDMS532dvdms00532
    • 2020-05-02
    160 min

    [DVDMS-536]A Normal Boys And Girls Focus Group Adult Video A Big Tits Amateur College Girl Is Wearing Only A Towel And Taking The Consecutive Cock Nookie Challenge With All Of The Male Customers At The Sauna! 2 This College Girl Was Surrounded By Roc

  • censoredcreampiebig titsDVDMSdeep syosukeDVDMS-536DVDMS536dvdms00536
    • 2020-05-01
    120 min

    [ONEZ-238]Broke College Girls' Job Hunting File 002: The Situation Of Anna Minami (Pseudonym), A 22 Year Old S*****t Due To Graduate From N College's Economics Department, Who Wants To Join A Major Advertising Agency

  • censoredcreampieamateurONEZprestigetodoonezONEZ-238ONEZ238118onez00238
    • 2020-04-28
    164 min

    [EQ-515]Will You Squeeze My Big Tits？ Picking Up Local Amateurs With Big Tits!

  • censoredcreampiebig titsEQbullittrocket taropretty honey brittEQ-515EQ515h-100eq00515
    • 2020-04-25
    141 min

    [JUFE-168]This No-Good Guy Entrances Specific Body Parts! The Top Half Of Her Body Isn't Interested, But Her Pussy Cums So Hard When She Gets Fucked That It Twitches Eimi Fukada

  • emi fukada censoredcreampiebig titsJUFEfitchno directorJUFE-168JUFE168jufe00168
    • 2020-04-19
    120 min

    [HND-821]Fresh & Cute! - A College Girl With A Short Bob Cut Has Her First Ever Creampie Sex - Saki Shida

  • saki shida censoredcreampiebeautiful girlHNDhon nakausa pyonHND-821HND821hnd00821
    • 2020-04-17
    118 min

    [MRSS-088]A Wife Of Around Thirty Enters University From The Working World. She Resolved To Dedicate Herself Completely To Study, But Is Easily Led Astray By The University's Socials And Hookups Society, And Gets Creampied At An Orgy Party Mai Ka

  • kamisaki mai censoredcreampiesingle workMRSSmisesu no sugao emmanuellenortonmisses amateur faceMRSS-088MRSS088mrss00088
    • 2020-04-16
    160 min

    [MVSD-424]185 Days of Continuous Creampie Akari Neo

  • akari neo censoredcreampiebig titsMVSDm s video groupkogoro kindaichiMVSD-424MVSD424mvsd00424
    • 2020-04-10
    199 min

    [BAZX-230]Recruiting In Business Suits vol. 002

  • censoredcreampieblowjobBAZXmedia stationtodobazookaBAZX-230BAZX23061bazx00230
    • 2020-04-07
    123 min

    [KTRA-205]A Serious Girl With Big Tits Does A Secret Sex Job - Suzu Shiratori

  • swan tin censoredcreampiebig titsKTRAk tribeno directorKTRA-205KTRA205h-094ktra00205
    • 2020-04-04
    243 min

    [DVDMS-522]Monitoring Ordinary Men And Women - Amateur College S*****ts - Male And Female Friends Enter An Escape Room Where The Only Way Out Is To Provide 20ml Of Semen! 4 - College Girls Do Handjobs, Blowjobs, And Full-On Sex Until They Collect The

  • censoredcreampieamateurDVDMSdeep sgreenhouse effectDVDMS-522DVDMS522dvdms00522
    • 2020-04-04
    120 min

    [PRED-229]A Real-Life Amateur JD Gets Her Sensuality Developed File.001 When She Gets Her G-Spot Stimulated, This Beautiful Athlete's Slender Body Begins To Spasm And She Begs With Teary Eyes To Be Released From This Living Hell Of Continuous Org

  • censoredcreampiesquirtingPREDpremiumtrendy yamaguchielegancePRED-229PRED229pred00229
    • 2020-04-01
    121 min

    [NACR-318]Art S*****t With Light Skin And Beautiful Tits Sakura Sayane

  • kiyoshi saki censoredcreampiebeautiful girlNACRplanet plusdirector onanakuruNACR-318NACR318h-237nacr00318
    • 2020-03-28
    118 min

    [WANZ-943]Driving My Girlfriend Crazy With Sex On A Business Trip Beautiful Tits At The Massage Parlor Ruka Inaba

  • inaba censoredcreampiebig titsWANZwanz factorywanzWANZ-943WANZ943wanz00943
    • 2020-03-21
    152 min

    [HND-812]On That Day, Our College Party Turned Into A Creampie G*******g Session The Welcoming Party Rei Kuruki

  • satoshi kuruki censoredcreampiebeautiful girlHNDhon nakaham the mcHND-812HND812hnd00812
    • 2020-03-21
    120 min

    [HND-805]A Fresh Face She Was Born In 2000 And Now She's Almost 20 Years Old A College Girl Who Grew Up In Fukuoka And Attends A Famous Women's University Is Making Her Adult Video Debut Minami Koga

  • minami koga censoredcreampiebeautiful girlHNDhon nakamametaro mamezawaHND-805HND805hnd00805
    • 2020-03-21
    117 min

    [HND-807]A Refreshing Real-Life College Girl Gets Happy And Shakes Her Ass With Cowgirl Lust In Her First-Ever Raw Creampie Fuck Mio Watanabe

  • mio watanabe censoredcreampiebeautiful girlHNDbookconcave styleHND-807HND807hnd00807
    • 2020-03-21
    235 min

    [REXD-322]An Accident In The Science Lab Means The Assistant Is Ready To Get Fucked! - She Mixes Some Chemicals, There's A Puff Of White Smoke, And Suddenly She's Half Naked!

  • censoredcreampieamateurREXDredmanji groupREXD-322REXD322rexd00322
    • 2020-03-21
    156 min

    [CAWD-066]Adultery At A Language Class - My Innocent Girlfriend Gets Fucked And Creampied By Chads - Mio Watanabe

  • mio watanabe censoredcreampiebeautiful girlCAWDkawaiikyouseiCAWD-066CAWD066cawd00066
    • 2020-03-19
    140 min

    [GEKI-004]Tokyo Hot Big Tits Idol Faith Squirting Cosmetologist Gem Momoe Takanashi

  • satoshi ichinose censoredcreampiebig titsGEKIan amazingly rare amateursuper lemonGEKI-004GEKI004geki00004
    • 2020-03-16
    86 min

    [SHN-041]Slut Getting Filled With Cum By A Married Man's Cock... The Jealous Gaze Of The Wife Witnessing Her Man Eating Out Another Girl Is Making Her Dripping Wet - College S*****t Mari

  • censoredcreampiebig titsSHNnatural hightanaka baconnach carefully selected daughterSHN-041SHN0411shn00041
    • 2020-03-14
    240 min

    [DVDMS-518]A Normal Boys And Girls Focus Group Adult Video College S*****t Babes Only A Thrilling Sleepover Mission That Will Test The Bonds Of Stepbrother And Stepsisterhood! If This College Girl Big Stepsister Spends The Night With Her Little Stepb

  • censoredcreampieamateurDVDMSdeep sDVDMS-518DVDMS518dvdms00518
    • 2020-03-14
    161 min

    [DVDMS-519]A Normal Boys And Girls Focus Group Adult Video College S*****t Couples Only A Thrilling NTR Mission! During A Double Date At A Hot Spring Resort, This Big Tits College Girl Is Taking A Cuckold Challenge With Her Friend's Boyfriend! Th

  • censoredcreampiebig titsDVDMSdeep sgreenhouse effectDVDMS-519DVDMS519dvdms00519
    • 2020-03-14
    200 min

    [DVDMS-516]A Black Man x An Amateur College Girl She's Getting Her First Big Black Semen Creampie Specials! This Black Man Who Lives In Japan Has An Excessively Big Dick And It's Been Giving Him Problems, But Now He's Consulting With An A

  • censoredcreampieamateurDVDMSdeep sking of genkingDVDMS-516DVDMS516dvdms00516
    • 2020-03-13
    243 min

    [SKMJ-093]Real Pickup With Amateur College Girls! - Going Back To College Girls' Rooms And Fucking Them Until They Cum! - Semen Flying Everywhere In Messy Bukkake Scenes! - Incredibly Cute Girls Only!

  • censoredcreampieamateurSKMJred face girlxyzSKMJ-093SKMJ093h-1324skmj00093
    • 2020-03-13
    242 min

    [SKMJ-092]Amateur College Girls Have Their First Mixed Bathing Experience! - See Their Perky Asses And Big Tits At Close Range! Their Faces Are Red With Embarrassment! They Get Their Bodies Licked And Their Pussies Creampied!

  • censoredcreampieamateurSKMJred face girlone topSKMJ-092SKMJ092h-1324skmj00092
    • 2020-03-12
    160 min

    [IENF-067]This Shinjuku College Girl's Sensitive Body Is Wet And Overcome With Sensation Just From Getting Her Thighs Fucked! She Begs To Keep Going No Matter How Many Times She Climaxes And Eventually Welcomes A Hot Load Inside Her!

  • censoredcreampieamateurIENFienergytiger kosakaiieneIENF-067IENF0671ienf00067
    • 2020-03-06
    169 min

    [EQ-507]Secret Hot Pranks Inside The Futon "Hey!？ My Boyfriend Is Going To Catch Us If We Keep Doing This!" She Got Fucked By Her Boyfriend's Friend And Now She's Enjoying Serious Raw Sex! 3

  • censoredcreampiebig titsEQbullittbalcony fuckingerotic touchingEQ-507EQ507h-100eq00507
    • 2020-03-01
    219 min

    [ZMAR-012]Totally! Free Kana

  • freedom censoredcreampiebig titsZMARplanet plusno directorthe whole damn thingZMAR-012ZMAR012h-237zmar00012
    • 2020-02-28
    237 min

    [MDTM-609]Raw Creampie In Sexy, Cute College Girl I Met On An Amazing App

  • hina nanase rui otowa censoredcreampiebeautiful girlMDTMmedia stationtetuchu kikakuMDTM-609MDTM60961mdtm00609
    • 2020-02-28
    242 min

    [SKMJ-090]Innocent Amateur College Girls Only! - These Girls Try Riding Cowgirl Style! - Look At Their Embarrassed Faces While They Get Their Tits And Asses Fondled! Their Pussy Juice Dribbles Down To The Guy's Balls, And Finally They Get Fucked

  • censoredcreampieamateurSKMJred face girlone topSKMJ-090SKMJ090h-1324skmj00090
    • 2020-02-22
    119 min

    [HND-792]A Tall And Slender College Girl With Beautiful Tits Who Wants To Become A School Teacher, But Before She Does That, She's Having Her First Creampie Fuck Shiori Niimi

  • niimi shiori censoredcreampiesingle workHNDhon nakatiger kosakaiHND-792HND792hnd00792
    • 2020-02-20
    138 min

    [GEKI-003]Picking Up A Tall Event Hostess In A Tight Sweater That Shows Off Her Big Tits, And Getting Her To Star In Her First Porno! - Nanao Takizawa

  • sena ai censoredanalcreampieGEKIan amazingly rare amateursuper lemonGEKI-003GEKI003geki00003
    • 2020-02-15
    245 min

    [NPS-391]Real Pickup! - Sexy Cute College Girls Only! - They Get Fucked To The Back Of Their Pussies Until They Almost Pass Out! - 131 Orgasms - 17 Ejaculations

  • censoredcreampieamateurNPSpeterskensuke kikuchinampazuNPS-391NPS391h-021nps00391
    • 2020-02-14
    151 min

    [HGOT-028]A Horny Boyfriend And An Obedient Girlfriend They're Trying To Keep Their Voices Down While Fucking Silently At Her Parents' House

  • beautiful sweetness yuki makimura censoredcreampiebig titsHGOTno studiorakudaHGOT-028HGOT028h-1414hgot00028
    • 2020-02-11
    124 min

    [KTRA-190]A Slender Domestic Girl With Tiny Tits - Hotaru Shinogawa

  • firefly oshinogawa censoredcreampiebeautiful girlKTRAk tribeno directorKTRA-190KTRA190h-094ktra00190
    • 2020-02-07
    233 min

    [HEZ-143]Nampa Seduction And Quickie Fucks!! 3 I Hauled In A Fresh College Girl And I Want To Fuck Her Right Away! - I Can't Wait Until I Get To A Love Hotel -

  • censoredcreampiebig titsHEZhot entertainmentkazuki enHEZ-143HEZ14359hez00143
    • 2020-02-07
    300 min

    [HEZ-136]Picking Up Amateur Girls - 11 Specially Selected Cute Girls!

  • censoredcreampiebig titsHEZhot entertainmentnetsuyujinHEZ-136HEZ13659hez00136
    • 2020-02-04
    292 min

    [SDMM-051]The Magic Mirror Number Bus This College Girl Desperately Wants To Have Fun, So Will She Accept Whatever We Say At This Perversion Interview!？ We Had Creampie Sex With 4 Job Hunting College Girl Babes

  • censoredcreampiebig titsSDMMsod createakira saijomagic mirrorSDMM-051SDMM0511sdmm00051
    • 2020-01-31
    298 min

    [SKMJ-084]An Amateur College Girl Gets A Real Pickup! An Innocent Beautiful Girl Gets Her First-Ever Female Readers Choice Sex Club Experience! 2 4 Pairs Of Amateur Girls And Guys Who Commit The Forbidden Act Of Fucking

  • censoredcreampieamateurSKMJred face girlyuseiSKMJ-084SKMJ084h-1324skmj00084



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi