jav javcensored high vision planning big tits




FC2ONEZMEYDAVSAMIAADASDFSDSSSHKDMARAABWHNDMVSDSTARSAPODSPRDAUKSNACRIPXDTTKSBJHDKA

2020-09-12
151 min

[ONNA-012]Collection Of Mihina Nagai's Shameful Works

  • mihina azumihina mihina nagai censoredblowjoblesbianONNAsadistic village nowi love this girlONNA-012ONNA0121onna00012
    • 2020-09-12
    115 min

    [EYAN-158]Her Husband's A Gangster... Could You Resist The Temptation Of This Hot Married Slut Knowing Your Creampie Might Be Your Last Eimi Fukada

  • emi fukada censoredcreampieslutEYANe bodyamazing meatwives of hanasagariEYAN-158EYAN158eyan00158
    • 2020-09-29
    46 min

    FC2PPV 1517817 Up to 12P‼ A super-slutty gal and a live gal ⑭ though she is a beautiful girl with a young lady

  • amateur uncensoredfc2
    • 2020-10-05
    51 min

    345SIMM-522 Yariman J ○ and Kimeseku Enko → Completely fallen into uncle tech → 3 consecutive vaginal cum shot onedari!

  • amateur censoredcreampieuniformsimmsimm-522simm522345simm-522
    • 2020-10-10
    161 min

    [JUNY-027]This Voluptuous And Beautiful 19-Year Old College Girl With A Small Waist And K-Cup Titties Is Juggling Two Part-Time Jobs At A Supermarket And An Izakaya Bar Mitama Awatsuki Her Adult Video Debut

  • awatsuki mitama censoredbig titssingle workJUNYfitchnikuyokuJUNY-027JUNY027juny00027
    • 2020-10-30
    31 min

    483HMHI-604 Yumi

  • amateur censoredamateurblowjobhmhihmhi-604hmhi604hmhi-604
    • 2020-10-30
    127 min

    [RD-1021]MILF Gets Tipsy At An Office Party, Now All The Guys Want To Nail Her "I Can Smell Your Booty Sweat And It's Making Me Horny..."

  • censoredmarried womanblowjobRDathena videomurayamaathenaRD-1021RD1021149rd01021
    • 2020-11-04

    FC2PPV 1557572 Limited number 4980 → 2980 [No] Continuous vaginal cum shot to G cup beautiful girl belonging to the office

  • amateur uncensoredfc2
    • 2020-11-06
    54 min

    417SRCN-048 Whip Butt Flasher J ● Discovered! !! Sneaking up on J ● who enjoys a fiercely dangerous propensity after school and getting a vaginal cum shot in Ma ● Ko who leaks Dada with shame excitement!

  • amateur censoredcreampieschoolgirlsrcnsrcn-048srcn048417srcn-048
    • 2020-11-06
    162 min

    [NKKD-183]This Married Woman Was On A Drive With Her Family, So We Took Her To A Bathroom In The Park And Fucked Her!! 3 Toilet NTR

  • censoredNKKDjet eizomanji groupNKKD-183NKKD183nkkd00183
    • 2020-11-06
    182 min

    [BGN-061]A Prestige Exclusive Fresh Face Debut An Overwhelmingly Translucent Shy Girl And Beautiful Girl Umi Yatsugake

  • yakake umi censoredsingle workBGNprestigec takerubeginningBGN-061BGN061118bgn00061
    • 2020-11-13
    31 min

    [CLO-093]A Beauty Salon Where, If You Meet Others' Gazes... - Ria Kashii

  • ria kashii censoredslutCLOchobitchchovicCLO-093CLO093h-1435clo00093
    • 2020-12-26

    C0930 ki201226 Self Shot

  • amateur uncensoredc0930
    • 2021-01-01
    144 min

    [SORA-289](Selfie Posting x Outdoor) Smoking Hot G-Cup MILF - She Got Swindled Into Cheating With A Coworker And We Caught The Whole Thing On Camera... Kasumi Ikeya (43 Years Old)

  • censoredamateurmature womanSORAyama to sorayosukeSORA-289SORA289sora00289
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266
    • 2021-01-22
    135 min

    [ABW-048]Strictly Looking Up From Below Only: The Specially SK**led Town Beauty Suzu Matsuoka At The Retreat 16: I Will Do Anything To Please Our Guests

  • matsuoka tin censoredanalblowjobABWprestigecharlie nakataabsolutely wonderfulABW-048ABW048118abw00048
    • 2021-02-07
    139 min

    [PKPD-129]Compensation Creampie Dating, Age 18, Colossal Tits, Cheerful Cumming Slut Hana Himesaki

  • himesaki hana censoredcreampiebig titsPKPDfuck group and fun friends daydreamersPKPD-129PKPD129pkpd00129
    • 2021-02-12
    150 min

    [EYAN-163]Her Husband's Away For Two Whole Days - This Busty Adulteress Is Down To Fuck Raw - Horny Faithless Wife Takes A Creampie

  • censoredbig titsEYANe bodylamb chopwives of hanasagariEYAN-163EYAN163eyan00163
    • 2021-02-12
    12 min

    FC2PPV 1683619 I did a lot of ejaculation in the flow at least with a premature ejaculation peni stick to a spear man gal in a sailor swimsuit

  • amateur uncensoredfc2
    • 2021-02-18
    155 min

    [MVSD-454]A College Girl Who Had Fallen So Far, She Was Now Working At A Low-Class Raw Fuck Soapland I Hated My Homeroom Professor So Bad I Could Die, But Now I Had To Service His Cock And Do As He Said And He Creampie Fucked Me. Rei Kuruki

  • satoshi kuruki censoredcreampiesquirtingMVSDm s video groupMVSD-454MVSD454mvsd00454
    • 2021-02-19
    115 min

    [EVIS-336]Old Fashioned Lesbian Public Bath Run By 4 Beautiful Sisters

  • is it igarashi censoredlesbianEVISebisusan mousouzokubyakkoEVIS-336EVIS336evis00336
    • 2021-02-20
    57 min

    10musume 022021_01 Not Wearing Make up Amateur : I put makeup on even I go out for a small errand Sanae Kiuchi

  • amateur uncensored10musume
    • 2021-03-06
    122 min

    [NKKD-197]Housewife Sweetly Wrapping A Younger Horny Guy Up In Her Freshly Worn Underwear And Milking Him Dry - Ka Ayano Fuji

  • ayano kato censoredbig titsmature womanNKKDjet eizomanji groupNKKD-197NKKD197nkkd00197
    • 2021-03-09
    140 min

    [STARS-334]Quick Fuck While On The Way To The Bathroom! Unable To Stand The Pleasure She Pisses Herself While Cumming! Ichika Nagano

  • ichika nagano censoredbeautiful girlsingle workSTARSsod createkyoseisod starSTARS-334STARS3341stars00334
    • 2021-03-25
    177 min

    [SW-766]Sexy Study Time With S********ls - Exploring Growing Girls' Bodies Until They're Ready For A Perfect 100 Score! Moaning After A Few Touches, These Sensitive Amateur Girls' Tight Pussies Get Wet And Eager To Learn How Cock Feels Al

  • censoredamateurSWswitchswitch switchSW-766SW7661sw00766
    • 2021-04-01
    120 min

    [NACR-412]Sex With A Married Woman Carrying Breast Milk, Impatient At Her Abstinence - Hinami Narisawa

  • hinami narusawa censoredcreampiebig titsNACRplanet plusbito sakurananakuruNACR-412NACR412h-237nacr00412
    • 2021-04-27
    82 min

    200GANA-2478 Seriously Nampa, first shot. 1627 A petite beautiful girl with a height of 148 cm! She is rolled up and swept away when she is attacked by an electric massage machine … Although she thinks it is bad for her boyfriend, she gets excit

  • amateur censoredamateurganagana-2478gana2478200gana-2478
    • 2021-05-01
    64 min

    324SRTD-0224 I Can’t Stand It Should Be Just An AV Interview And Insert A Runaway Student!

  • amateur censoredbig titsamateursrtdsrtd-0224srtd0224324srtd-0224
    • 2021-06-11
    161 min

    [IPX-667]-KANZETSU- G-Spot Development! Super Wet Sex Parts Ultimate Orgasms And Fucking To The Limit! Kotomi Ono

  • kotoyumi ono censoredsquirtingblowjobIPXidea pocketbungo maedadishIPX-667IPX667ipx00667
    • 2021-06-27
    58 min

    300NTK-595 [Premature ejaculation beautiful breasts] [Perfect style] [Beauty GAL] The best SEX experience … here! !! Tipsy Photoshop of sweet and rich milk tea gal! !! The sexual desire of the unfussy start explodes with the rising edge! !! Hit

  • amateur censoredcreampieamateurntkntk-595ntk595300ntk-595
    • 2021-07-10
    242 min

    [UMSO-403]A Perverted Maid Who Shows Off Her Masturbation Skills And Lures Her Master To Temptation In Broad Daylight!! vol. 02

  • kaho shibuya miki hazuki censoredbig titsUMSOk m produceumanamiUMSO-403UMSO403umso00403
    • 2021-07-17
    75 min

    FC2PPV 1927776 G-Cup Girl, Raw Saddle "Personal Shooting" Individual Shooting Completely Original 122nd Person While Enrolled In March At A Famous University

  • amateur uncensoredfc2
    • 2021-07-17
    179 min

    [HMN-012]Hello, I'm Ao-chaaan! Fresh Face 20-Year-Old Natural Airhead Beautiful Girl with Outstanding Cute Reactions Creampie AV DEBUT After 1 Year!! Ao Amano

  • ao amano censoredcreampiebig titsHMNhon nakausa pyonHMN-012HMN012hmn00012
    • 2021-07-27
    105 min

    SHPV-002 Nacchan

  • amateur censoredamateurbeautiful girlshpvshpv-002shpv002shpv-002
    • 2021-07-31
    240 min

    [MMB-380]Nipples Say A Thousand Words No Matter How She Tries To Hide It, Her Rock-Hard Nipples Reveal That She"s Just Begging To Get Fucked Video Of Women Convulsing As They"re Fucked Hard And Fast

  • arimura nozomi shirosuku kurosaki censoredMMBmomotaro video publishingdr ishikiri bridgemomotaro bestMMB-380MMB380mmb00380
    • 2021-08-01
    63 min

    SIRO-4586 [First Shot] [Pure Beautiful Girl] [Minimum Nude X Big Butt] A Spoiled Girl Advent Wearing A Petite And Pretty Atmosphere. Rippling A Plump Buttocks Disproportionate To The Body And Exposing A Foolery To The Relentlessly Approaching Strong

  • amateur censoredamateursirosiro-4586siro4586siro-4586
    • 2021-08-06
    135 min

    [MEYD-691]Commemorating 15 Years With Goro Tameike Collaboration No.7 An Unusual Full Option Creampie Adultery Fuck Fest With A Soapland Princess Lover Who Has No Boundaries Hitomi

  • hitomi censoredcreampiebig titsMEYDtameike goroshouten shirouMEYD-691MEYD691meyd00691
    • 2021-08-13
    124 min

    [MVSD-474]I Ended Up Sharing A Room With Young Female Graduate With A Slim Waist NTR Special She Let Me Fuck And Come Inside Her Minami Hatsukawa

  • hatsukawa minami censoredcreampiebeautiful girlMVSDm s video groupms video groupMVSD-474MVSD474mvsd00474
    • 2021-08-28
    65 min

    383REIW-092 Noa

  • amateur censoredcreampieamateurreiwreiw-092reiw092383reiw-092
    • 2021-09-09
    85 min

    FC2PPV 2180955 [Uncensored Leak] "Hatsumi Saki" Uncensored Raw Vaginal Cum Shot Video Leaked! 8 / Shaved Sequel Strongest Video Re-Shaving At A Later Date! Massive Sperm Raw Vaginal Cum Shot Sex!

  • amateur uncensoredfc2
    • 2021-09-17

    FC2PPV 2213482 [Latest Work] Kansai Trip With Erika For 2 Days And 1 Night! Erika-Chan Is Naughty Even During A Date!

  • amateur uncensoredfc2
    • 2021-09-23
    120 min

    [FSDSS-287]小野夕子の超スケベなプライベートAV！！ 完全二人きりの温泉旅行で遂に見せた何でもアリの素顔丸見え超リアルSEX映像

  • yuko ono censoredbig titssingle workFSDSSfalenofaleno starFSDSS-287FSDSS2871fsdss00287
    • 2021-09-24
    205 min

    [HUNTB-105](I"m Sorry...! I"m Coming!) I Ended Up Sharing A Room With A Haughty Junior Female Employee During A Business Trip. Now She"s Tied Up While I Piston Her And Make Her Come! Sharing A Room With A Coworker Because I Messed Up The

  • censoredcreampieblowjobHUNTBhunterkonnyaku kannohhh groupHUNTB-105HUNTB105huntb00105
    • 2021-10-09
    121 min

    [LUNS-084]The Sex Lives of Middle-aged Married Couples 2

  • censoredcreampiebig titsLUNSluna shunkoushaLUNS-084LUNS084luns00084
    • 2021-10-15
    75 min

    483SGK-040 [Frustrated Dirty Wife] [Slender Former Nurse] [Slippery Shaved] [Marriage History 2 Years Older Husband] [Unrivaled Deep Kiss Demon] [Katchikachi Big Penis Love] Frustrated Married Woman And Pakopako Who Sent Dm On Sns Shooting Yome-Chan.

  • amateur censoredmarried womanamateursgksgk-040sgk040483sgk-040
    • 2021-12-03
    119 min

    [MIDV-014]One Facial On Top Of Another Facial, With A Huge Load Of Spunk - Nao Jinguji

  • jinguji temple nao censoredbeautiful girlslutMIDVmoodyzoosaki hirokoujimoodyz divaMIDV-014MIDV014midv00014
    • 2021-12-03
    243 min

    [ID-034]Beloved Call Girl - Special Edition. AV Debut Married Woman - Real Amateur. Shocked After Inviting This Call Girl Over! It Turns Out To Be The Wife I See Living At The High-end Condos In Front Of My Shabby Apartment Building! And She Looks Ju

  • mari rika censoredcosplaysingle workIDtmaID-034ID0345526id00034
    • 2021-12-04
    74 min

    200GANA-2583 Seriously Nampa, First Shot. 1724 Picking Up An Office Lady Who Is Tired Of Drinking With Her Boss! Have Fun Drinking The Second One And Take It Home To The Hotel! Massive Squirting With Fingering And Ji ● Po! Pant With A Half-Voiced Voi

  • amateur censoredsquirtingamateurganagana-2583gana2583200gana-2583
    • 2021-12-11
    120 min

    [REAL-784]Reliving A Memory Over And Over As Soon My Body Is Taken... Flash Back To Being Taken Advantage Of. Himari Kinoshita

  • himari kinoshita himari hanazawa censoreddeepthroatsingle workREALreal worksjohnny shibuyareal real worksREAL-784REAL784real00784
    • 2021-12-31
    119 min

    [CAWD-323]Gazing, Whispering, Kiss-loving Girl"s Moist Kiss Seduction And Mucous Membrane Exchange Sex Natsu Hyuga

  • natsu hinata censoredcreampiebeautiful girlCAWDkawaiimichiru arashiyamaCAWD-323CAWD323cawd00323
    • 2022-01-22
    240 min

    [UMSO-433]Gorgeous House Cleaner Puts Aside Her Work And Seduces The Man Of The House By Masturbating In Front Of Him 15 Women

  • otsuki sound shiina sky censoredcreampieUMSOk m produceumanamiUMSO-433UMSO433umso00433
    • 2022-01-24
    94 min

    [SPRBD-065]I Want To Look At You, Always/Ichika Seta

  • kazuhana seta censoredbig titsbeautiful girlSPRBDintec incsuperlativeSPRBD-065SPRBD065h-706sprbd00065
    • 2022-01-25
    61 min

    1Pondo 012522_001 A Bride Who Is Trained In Anal Development By Her Father-In-Law Aisa Tamano

  • amateur uncensored1pondo
    • 2022-02-19
    158 min

    [DGCEMD-133]*Limited Release! Includes Bonus Video* Age Difference And Lesbians, No Problem! Alice Kisaki with Chisato Shoda ...Woman Gets Her First Lesbian Pleasures And Writhes In Pleasure All Over the Bed!

  • kisaki alice shota chisato censoredbig titslesbianDGCEMDceleb no tomoDGCEMD-133DGCEMD133dgcemd00133
    • 2022-02-19
    74 min

    FC2PPV 2672887 F Cup Huge Breasts JD While Attending A Super Prestigious University With A Deviation Value Of 72. An Intelligent Girl Who Is Big And Has Outstanding Sensitivity Is A Huge Amount Of Squirting. She Was Worried, "Don’t You Put O

  • amateur uncensoredfc2
    • 2022-02-22
    84 min

    [MDON-011]Only Available Online: Madonna"s Exclusive Starlets Unfettered For "Real". Welcome to MADOOOON!!!! POV Fun With Nao Jinguji

  • jinguji temple nao censoredbig titsmature womanMDONmadonnamadoooonMDON-011MDON011mdon00011



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi