jav javcensored leg fetish




FC2VEMAHODVCJODBLKAUKGADNHDKAROYDDTTDASDSPRDMILKCESDCAWDMIAAFSDSSBBANPPPDNNPJVENX

2020-12-01
175 min

[SE-198]"Not Inside Me" She Said, But The Gross Old Fat Guy With Bad Breath Who Was Nailing Her Didn't Listen "I'll Give It Back Ten Times Worse!" (Director) Kurumi Suzuka (Amateur Hooker Creampie 1)

  • suzuka walnut censoredcreampieamateurSEplumposted by akiraamateur only plumSE-198SE198h-113se00198
    • 2020-12-10
    240 min

    [HBAD-567]She's Using Her Fully Ripe Big Tits And Super Limber Limbs To Mesmerize My Cock And Take Care Of My Lust

  • marina yuzuki aya takashiro censoredbig titsblowjobHBADhibinobabeHBAD-567HBAD5671hbad00567
    • 2020-12-11
    250 min

    [MDTM-690]Super Horny Girls from an Elite Girls School Show Us Their True Colors 10

  • kamikawa starry sky red fruit censoredcreampieuniformMDTMuchu kikakutetMDTM-690MDTM690h-585mdtm00690
    • 2020-12-24
    121 min

    [FSDSS-147]She'll Service You From Head To Toe - Whole Body Super Slut Maid Ena Satsuki

  • ena satsuki censoredbig titsbeautiful girlFSDSSfalenokirinfaleno starFSDSS-147FSDSS1471fsdss00147
    • 2021-01-16
    149 min

    [SSNI-965]No Script! POV! No Makeup! Anything Goes! Aika Yumeno 's Bare Naked, Carnal True Self - Sex Like She'd Have At Home! Ultra Rare 200 Erotic Real Couple's Hot Spring Trip Video

  • yumeno aika censoredbig titssingle workSSNIs1 no 1 styleSSNI-965SSNI965ssni00965
    • 2021-01-21
    118 min

    [AKDL-078](An Amateur Interview) She's Not Telling Her Husband That She's Performing In An Interview She's Got Short Hair Up Top, And A Bushy Bush Down Low, And She'll Grind Like A Horny Bitch During Cowgirl Sex And Keeps On Screaming

  • censoredmarried womanamateurAKDLaquinoriaquinoriaknrAKDL-078AKDL0781akdl00078
    • 2021-01-23
    148 min

    [CAWD-170]She's Studying Hard At Pharmacy School! This Highly Educated, Budding Gravure Idol With A Great Body Wants To Also Learn About Sex, So She's Lifting Her Adult Video Ban!! She's Baring Her Tits And Pussy And Making Her Nervous De

  • yuzu hasegawa censoredbeautiful girlsingle workCAWDkawaiigoemonCAWD-170CAWD170cawd00170
    • 2021-01-23
    119 min

    [NNPJ-427](Usually I Would Never Fall For This Trick) She's Smiling Bravely, But She Was Dumped By Someone She Loved... And She Was So Lonely, She Allowed Herself To Be Seduced.

  • censoredcreampieblowjobNNPJnanpa japanNNPJ-427NNPJ427nnpj00427
    • 2021-01-27
    79 min

    259LUXU-1373 Luxury TV 1358 [Natural busty sister is coming again! ] I want to see the overwhelming big tits that sway and dance with each piston forever! I’m thrilled by the gestures that sway the man’s heart …! Because of the greedy

  • amateur censoredbig titsamateurluxuluxu-1373luxu1373259luxu-1373
    • 2021-01-29
    129 min

    [DIC-082]A Meaty Boxing Ring Girl Who Loves To Fuck Martial Artists Rika Sasaki Her Adult Video Debut! She's Got A Floor Game That's Practically Illegal As She Burns Through 4 Straight KOs A Complete Game, Undefeated Match Against A Cock!!

  • rika sasaki censoredsingle workDICprestigetsuruhashidiscoverDIC-082DIC082118dic00082
    • 2021-02-01
    123 min

    [CLOT-015]Pantyhose Temptation Suzu Monami

  • monami bell censoredcreampiecosplayCLOTplanet plusdirector ocloseCLOT-015CLOT015h-237clot00015
    • 2021-02-05
    71 min

    300NTK-513 SEX apt! !! A beautiful gamer with a tall F cup! !! Even if you lose the punishment game, you can win at the woman on top posture! !! Two shots of continuous vaginal cum shot with E-sports sex of lack of exercise & libido elimination o

  • cmfjd censoredcreampieamateurntkntk-513ntk513300ntk-513
    • 2021-02-06
    181 min

    [NKKD-196]My Wife (28 Years Old) Got Fucked By The Part-Time Worker (20 Years Old) At Her Part-Time Job... And I Was Feeling So Frustrated And Angry That I Want To Sell This Footage As An Adult Video. (NKKD-196)

  • censoredmature womanslutNKKDjet eizomanji groupNKKD-196NKKD196nkkd00196
    • 2021-02-21
    62 min

    413INST-098 Mayu-chan ☆ 18 years old ☆ Big breasts G cup girl who is being turned on by all her classmates! I really love sex ♪ I’m crazy by shaking the super sensitive milk that gets caught with just the nipple ♪

  • amateur censoredbig titsamateurinstinst-098inst098413inst-098
    • 2021-03-06
    736 min

    [ATAD-156]ATTACKERS Actress Directory 3 - Saeko Matsushita - 12 Hours

  • saeko matsushita censoredbig titssingle workATADattackersattackers anthologyATAD-156ATAD156atad00156
    • 2021-03-12
    481 min

    [KPB-016]Best Of Married First Timers 20 Women 80 Hours Vol 03 (Endless Lust + Creampie + Sexy Bodies)

  • censoredcreampiebig titsKPBprestigekanbiKPB-016KPB016118kpb00016
    • 2021-03-27
    150 min

    [BDSR-444]My Step Sister Was My First Love... Bittersweet Pure Love Life Mizuki Yayoi

  • mizuki yayoi censoredcreampiebig titsBDSRbig morkalyumejiBDSR-444BDSR44457bdsr00444
    • 2021-04-02
    186 min

    [HUNTA-977]Monthly All You Can Fuck Program! As Long As You Pay A Monthly Fee You Can Fuck Any Of The Female Employees And Receptionists! 2

  • censoreduniformHUNTAhunterkorosukehhh groupHUNTA-977HUNTA977hunta00977
    • 2021-04-02
    119 min

    [JUL-537]On A Two Night Three Day Trip I Was Ordered To Stay In The Hotel And Ended Up Seducing The Hot Receptionist... Aoi Mukai

  • ai mukai censoredmature womansingle workJULmadonnasatsugu koyamaJUL-537JUL537jul00537
    • 2021-04-10
    134 min

    [APKH-169](Petite Body With G-Cup Tits) Her Tiny Young Pussy Smells Fresh And Delicious - Perfect For Thick Rods! This College Girl's Job Hunting But She Wants To Be A Voice Actress - POV Footage Hina Shinjo

  • hina shinjo censoredcreampiesingle workAPKHaurora project annexhaurora project anexAPKH-169APKH169apkh00169
    • 2021-04-17
    72 min

    300NTK-554 A miracle! !! Beautiful x cute quarter-rolling beautiful girl! !! We are proud of our whitening soft skin pink nipples and peach butt! !! Needless to say, the sensitivity is good. The owner of the squirting maco! !! Just a squirting profes

  • amateur censoredcreampiesquirtingntkntk-554ntk554300ntk-554
    • 2021-04-22
    135 min

    [CHN-200]新・素人娘、お貸しします。 97 仮名)美波ゆら(無職)22歳。

  • amateur censoredbig titsamateurchnchn-200chn200chn-200
    • 2021-05-21
    167 min

    [MISM-202]Crazy Obedient Masochist Sana (Fake Name) With Colossal Tits Gets Her Throat And Pussy 100 Hardcore Trained - This Dark And Moody Girl Loves Being Broken In With Perverted SM Techniques

  • censoredcreampiebig titsMISMm girls labtakuanMISM-202MISM202mism00202
    • 2021-05-22
    44 min

    FC2PPV 1831192 147cm E Cup ♥ Chibi Big Breasts Chika (19 years old JD) "It was warm ♥" I was fascinated by the first sperm bukkake in my life … Suddenly in the bath! In the washroom! !! [4th]

  • amateur uncensoredfc2
    • 2021-05-27
    42 min

    10musume 052721_01 The Structure Of Woman : Measuring Size of My Barely Legal Body Parts Keiko Miyahara

  • amateur uncensored10musume
    • 2021-06-04
    142 min

    [BF-634]My Subordinate Is Usually Plain And Prim And Proper, But When She Gets Excited, She Turns Into A Maneater. I Was No Longer Able To Resist, So I Creampie Fucked Her, Over And Over Again. Mikako Horiuchi

  • mikako horiuchi censoredbig titsslutBFbefreeroku yonBF-634BF634bf00634
    • 2021-06-12
    125 min

    [BAHP-081]Happening Hotel - Voluptuous G-Cup Bride's Secret Extracurricular Activities - Extreme Orgasmic Sex With A Man Who Isn't Her Husband - Mayu Suzuki

  • suzuki mayu censoredbig titsblowjobBAHPbaltandaibutsu yoshidahoppinBAHP-081BAHP081bahp00081
    • 2021-06-12
    119 min

    [AUKG-514]Denim Maniacs H

  • nagatsuki natsuki shizuka sugisaki censoredlesbianAUKGu krentoAUKG-514AUKG514aukg00514
    • 2021-06-14
    54 min

    [SDFK-049]These Beautiful Babe In A Hot Swimsuit Is Boarding The Magic Mirror Number Bus For The First Time, And Getting A Sensual Massage On Her Hot And Tanned Beautiful Ass This Sensual And Tanned Bikini Babe Came 4 Times And Pissed Herself Silly .

  • censoredsquirtingSDFKsod createchain sectmagic mirrorSDFK-049SDFK0491sdfk00049
    • 2021-06-24
    61 min

    1Pondo 062421_001 Home visit sexual intercourse with a teacher Rino Sakuragi

  • amateur uncensored1pondo
    • 2021-06-25
    121 min

    [MIAA-460]Substitute Pregnancy Wife - Beloved Stepdaughter Cums And Gets Pregnant While Fucking Stepfather - Rina Takase

  • rina takase censoredcreampieslutMIAAmoodyzhiromichi hoseeveryone s porn starMIAA-460MIAA460miaa00460
    • 2021-07-10
    125 min

    [SABA-709]Karina is a 33-year old horny housewife with short hair lusting for big cocks and NTR. On the day of her ovulation, she's told by her frigid and infertile husband with erectile dysfunction to go and make babies in a hotel from morning t

  • censoredcreampieSABAskyu shirototodoSABA-709SABA709saba00709
    • 2021-07-10
    81 min

    200GANA-2519 Seriously Nampa, first shot. 1660 Belochu on the street with a slender beauty JD who would have been drinking on the street while seeing cancer in her legs and legs! By the time I brought him to the hotel, he was a good friend and he was

  • amateur censoredamateurganagana-2519gana2519200gana-2519
    • 2021-07-10
    164 min

    [CEMD-034]She Gets Flirty and Open! Shame Play Rin Miyazaki - With Unfocused Eyes "I want to fuck already!" She Says.

  • miyazaki rin censoredcreampiemature womanCEMDceleb no tomoCEMD-034CEMD034cemd00034
    • 2021-07-20
    120 min

    [SPZ-1110]Completely Unexpected! Special Collection Of Hardworking Older Women Who Open Up Their Legs When Asked!

  • censoredcreampieuniformSPZstar paradisestar paradiesSPZ-1110SPZ1110h-254spz01110
    • 2021-07-22
    483 min

    [FCDSS-011]A Horny Big Tits Elder Sister Full Course Service Slut Plays Yuko Ono Best Hits Collection 8 Hours

  • yuko ono censoredbig titsslutFCDSSfalenofaleno starFCDSS-011FCDSS0111fcdss00011
    • 2021-07-30
    160 min

    [DVDMS-697]A Normal Boys And Girls Focus Group Adult Video This Business Man And Woman Had Sex On The Magic Mirror Number Bus, And We Followed Up On Them To See What Happened In This Special A Married Woman Office Lady And Her Male Colleague Are Out

  • censoredcreampieamateurDVDMSdeepspoolsideDVDMS-697DVDMS697dvdms00697
    • 2021-08-07
    118 min

    [LUNS-078]Immoral Fuck Ravaging The Bride"s Mother 7

  • censoredcreampiemature womanLUNSluna shunkoushaLUNS-078LUNS078luns00078
    • 2021-08-07
    217 min

    [BAZX-301]Thick Sex With A Widow In Mourning Dress vol. 005

  • censoredcreampieBAZXk m producetodobazookaBAZX-301BAZX301bazx00301
    • 2021-08-12
    114 min

    [IENF-159]I"m A Loser, But My Big Tits Big Sister Said, "I"ll Let You Rub Your Cock Up Against Me," And Made Me Promise Only To Grind, But We Both Started To Feel So Good, And Her Pussy Was Dripping Wet, So My Dick Just Slipped Right

  • tsukishima sakura hanamiya amu censoredcreampiebig titsIENFie nergyienfIENF-159IENF1591ienf00159
    • 2021-08-13
    161 min

    [PPPD-952]120 Points For Those Boobs! She"ll Do Anything A Beauty Wouldn"t do. A Convenient Meaty Big Tits Girl"s JAV Debut. Kotoha Ayase

  • ayase is censoredbig titssingle workPPPDoppaiPPPD-952PPPD952pppd00952
    • 2021-08-15
    74 min

    FC2PPV 2026328 * Complete Appearance [International Student Dutch J ●] 18 Years Old J ● Melo-Chan. Cross-Species Seeding Raw Vaginal Cum Shot. She Is A Cosplay Gonzo. * Outflow Limited Deletion

  • amateur uncensoredfc2
    • 2021-09-06
    124 min

    FC2PPV 2163461 "Hatsumi Saki" Uncensored Raw Vaginal Cum Shot Video Leaked! 5/2 Hours From Your Point Of View! Muramura Max’S Geki Kawa Sakipo-Chan

  • amateur uncensoredfc2
    • 2021-09-09
    124 min

    [FSDSS-289]I Had Always Loved My C***dhood Friend, And Now I Found Out That She Had Become The No.1 Prostitute ... I Ordered All Of The Available Options And Had Real Sex With Her, With Unlimited Ejaculations, In A 3-Day Fuck Fest Together Arina Hash

  • there is hashimoto censoredbeautiful girlFSDSSfalenomeatfaleno starFSDSS-289FSDSS2891fsdss00289
    • 2021-09-17
    109 min

    483SGK-043 [Geki Yaba Libido 5 Barrage] [This Year’s Sensitive Award] [Super Cute] [Woman Loved By The Climax God] Finally Came! !! A Ridiculously Erotic Gal Has Finally Arrived! !! !! Convulsions And Tides Are Bizarre And Super Exciting! What&#

  • amateur censoredcreampieamateursgksgk-043sgk043483sgk-043
    • 2021-09-18
    86 min

    FC2PPV 2217618 Crying! !! Tears. "Genuine Amateur" "Genuine Tears" Foreign-Affiliated Cosmetics Salesperson, "Tears Porori" Lori Beautiful Amateur Beauty S ○ X Begins To Cry, And Even If She Is Crying, She Cums Inside The Bea

  • amateur uncensoredfc2
    • 2021-09-18
    144 min

    [MMYM-048]Big Tits Big Butt Erotic Seduction Pheromone Yuri Honma

  • really censoredbig titsslutMMYMmarrionyumeno aidayumenoMMYM-048MMYM048mmym00048
    • 2021-10-09
    241 min

    [UMSO-418]Super Tall! 12 Slender Beauties

  • hikari yoshizawa hikaru konno censoredUMSOk m produceumanamiUMSO-418UMSO418umso00418
    • 2021-10-16
    150 min

    [GS-2026]Married Woman Hot Water Love Trip 144

  • kotohane hori censoredmarried womanGSgo go zukaraki take shigosGS-2026GS2026
    • 2021-10-28
    131 min

    [JRZE-082]Entering The Biz at 50! Atsuko Yashiro

  • atsuko yashiro censoredcreampiemature womanJRZEcenter villageminatoyashoku ureJRZE-082JRZE082h-086jrze00082
    • 2021-10-29
    162 min

    [MIAA-521]The Absolute Aerial Domain She"ll Jam Your Cock Into Her Silky Smooth Cunt Crack And Between Her Thighs And Toy With You Because She"s A Devilish Barely Legal Babe Ichika Matsumoto

  • ichika matsumoto censoreduniformslutMIAAmoodyzmasaki naominna no kikatanMIAA-521MIAA521miaa00521
    • 2021-10-29
    157 min

    [JUNY-048]The Ban is Lifted at Last! An Explosive Ass, A Big-Time Orgasm, The Pleasures of an Anal Fuck. Rio Ohara

  • osamu osamu censoredanalsingle workJUNYfitchnikuyokuJUNY-048JUNY048juny00048
    • 2021-11-13
    63 min

    355OPCYN-200 Yu (Yu Shinoda)

  • amateur censoredbig titsamateuropcynopcyn-200opcyn200355opcyn-200
    • 2021-12-12
    60 min

    230OREC-966 Dr. Aihara (Tsukiha Aihara)

  • amateur censoredcreampiebig titsorecorec-966orec966230orec-966
    • 2021-12-15
    44 min

    229SCUTE-1162 Airi (20) S-Cute Love Juice Squirting Sex (Airi Momose)

  • amateur censoredsquirtingamateurscutescute-1162scute1162229scute-1162
    • 2021-12-30
    61 min

    1Pondo 123021_001 Glamorous: Hina Hodaka

  • amateur uncensored1pondo



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi