jav schoolgirl sailor suit javcensored censored




FC2LULUNACRNGODAMBIMVSDMILKPPPDVEMADASDCESDCHRVSPRDAVSAAWDIPXAPODABWJUFENATRGMEM

2020-11-19
115 min

[PPPD-885]The Busty Teacher's Allure - Yuria Kano

  • yulia kano censoredbig titsslutPPPDoppaiPPPD-885PPPD885pppd00885
    • 2020-11-20
    75 min

    [OTIM-045](Online Exclusive) (Daydream POV) "My Teacher Calls Me After Class Every Day To Do Dirty Things" Rara Momota

  • also brought censoredcreampieuniformOTIMprestigeonetimeOTIM-045OTIM045118otim00045
    • 2020-11-25
    35 min

    S-Cute if_016_04 If I could spend the day with the little devil Ichika-PM10: 00 / Ichika

  • ichika censoredamateurifif-016if016if-016-04
    • 2020-11-26
    109 min

    [mgmr-130]HIMARI(23)

  • amateur censoredamateurbeautiful girlmgmrmgmr-130mgmr130mgmr-130
    • 2020-11-29
    148 min

    [LULU-047]"Your Dick Is So Bundled Up! I'm Going To Peel You And Make You Nice And Clean" My Big Tits Big Stepsister Works For A Bathhouse And She Started Cleaning My Uncircumcised Cock And Then She Used Her Sexy Body To Give Me All The N

  • yu asakura censoredcreampiebig titsLULUlunaticsluminaxLULU-047LULU047lulu00047
    • 2020-12-08
    42 min

    362SCOH-017 [Creampie] Let a carefully selected beautiful girl cosplay and conceive my child! [Hino ● I]

  • amateur censoredcreampiesquirtingscohscoh-017scoh017362scoh-017
    • 2020-12-18
    116 min

    [VEMA-153]Naughty Homeroom Teacher Horny For Her Male S*****ts Pays Them A House Call... While Their Parents Are Away Ai Mukai

  • ai mukai censoredcreampiemature womanVEMAvenuspetermegami venusVEMA-153VEMA153vema00153
    • 2020-12-20
    177 min

    [CAWD-157]Drop Dead Gorgeous Girl Working At A Beauty Parlor Enjoys Porn, So Why Not Make One For Herself？ With Her Clothes Off She's A Fair-Skinned Babe With Hard, Sensitive, Pink Nipples! With A Sweet Personality She Makes For The Perfect kawai

  • censoredsquirtingamateurCAWDkawaiiusa pyonCAWD-157CAWD157cawd00157
    • 2020-12-20
    180 min

    [CAWD-153]My Sister-In-Law Showed Up Out Of Nowhere Wearing A Miniskirt Without Panties. She Stayed At Our House For Three Days And Seduced Me - This Sexy Slut In Uniform Made Me Give Her a Creampie, Too Moko Sakura

  • sakura moko censoredcreampieuniformCAWDkawaiigoemonCAWD-153CAWD153cawd00153
    • 2020-12-25
    43 min

    [DHT-227]A More-Than-20-Years-Age Gap May-December Romance Set Up On A Hookup App Seducing Girls Who Love Withered Old Men Kurumi 21 Years Old

  • censoredamateurbeautiful girlDHThot entertainmententhusiastDHT-227DHT22759dht00227
    • 2021-01-02
    39 min

    361SEKAO-143 Candice Nicole from L.A

  • amateur censoredamateursekaosekao-143sekao143361sekao-143
    • 2021-02-03
    54 min

    FC2PPV 1671179 Limited time [Uncensored] Supporting a big tits cafe manager, continuous vaginal cum shot

  • amateur uncensoredfc2
    • 2021-02-04
    150 min

    [NITR-505]Pervert`s Hunt For Married Woman With Big Tits VII Nene Tanaka

  • nene tanaka censoredcreampiebig titsNITRcrystal eizoharuo miyafujinitroNITR-505NITR50549nitr00505
    • 2021-02-11
    138 min

    [IESP-676]Suzu Monami: Lesbian Unleashed - I Fell In Love With My Step-sister

  • monami bell toua kotone censoredlesbiandramaIESPienergykikuriniespIESP-676IESP6761iesp00676
    • 2021-02-20
    57 min

    10musume 022021_01 Not Wearing Make up Amateur : I put makeup on even I go out for a small errand Sanae Kiuchi

  • amateur uncensored10musume
    • 2021-03-05
    37 min

    [BTH-123]My Cold Cruel Wife Is A Slutty Animal Renowned For Taking Orders Chiharu Nakai

  • chiharu nakai censoredmarried womanBTHchobitchchovicBTH-123BTH123h-1435bth00123
    • 2021-03-11
    50 min

    Pacopacomama 031121_445 Horny Wife Helps to Lose Younger Boy’s Virginity 2 Kanon Mikoshiba

  • amateur uncensoredpacopacomama
    • 2021-03-19
    117 min

    [DDOB-089]Masochist Nursing Mother Cums While Shooting Milk From Her Tips Hinami Narusawa

  • hinami narusawa censoredmature womansingle workDDOBdogmatenunmy auntDDOB-089DDOB089ddob00089
    • 2021-03-29
    60 min

    345SIMM-627 [5 consecutive vaginal cum shot] Beautiful busty bitch mom with a slaughtered body brushes down Virgin-kun! Squeezing SEX with a maximum degree of nastyness that devours young sperm! !!

  • amateur censoredcreampiebig titssimmsimm-627simm627345simm-627
    • 2021-04-16
    53 min

    [tkwa-166]みなみ 2

  • amateur censoredcreampiebig titstkwatkwa-166tkwa166tkwa-166
    • 2021-05-06
    62 min

    Caribbeancom 050621-001 A young wife who is taking out her trush sex so easy Mikuro Komori

  • mikuro komori uncensoredhandjobcaribbeancom
    • 2021-05-07
    131 min

    [HBAD-583]Big Titty Home Delivery College Girl Anime Otaku And Cosplayer With Huge Tits Loves Older Men! Her Whole Body Is A Sexual Organ That Has Her Cumming Over And Over!

  • censoredbig titscosplayHBADhibinobabeHBAD-583HBAD5831hbad00583
    • 2021-05-14
    120 min

    [PPPD-929]Getting Horny Seeing My SIster-in-law's Big Tits When She Came Home After Having Been Fucked! I Followed Her And Creampied Her After Some Rough Sex... Eimi Fukada

  • emi fukada censoredcreampiebig titsPPPDoppaiPPPD-929PPPD929pppd00929
    • 2021-05-21
    48 min

    511SDK-010 Mao

  • amateur censoredbig titsamateursdksdk-010sdk010511sdk-010
    • 2021-05-28
    141 min

    [MMND-198]"I Could Never Appear In An Adult Video" Rian Aoi Colossal Tits x A Massive Ass A Horny And Obedient Flesh Fantasy Pet An H-Cup Voluptuous College Girl Will Provide You With All The Fucking You Could Ever Want!

  • rian aoi censoredbig titssingle workMMNDmimanyuki iwasawaMMND-198MMND198mmnd00198
    • 2021-05-28
    178 min

    [JUNY-036]Shocking K-Cup Titties! A Voluptuous Married Woman Cram School Instructor Let Her Lust Explode And Now She's Making Her Adult Video Debut!! Akiho

  • censoredbig titsJUNYfitchnikuyokuJUNY-036JUNY036juny00036
    • 2021-06-05
    117 min

    [LOL-195]Mouth Specialist... "Stepbrother, Forgive Me..." Marina Keeps Getting Fucked By Her Stepbrother! With Marina Saito

  • marina saito censoredcreampiebeautiful girlLOLglay zloli senkaLOL-195LOL19512lol00195
    • 2021-06-05
    52 min

    FC2PPV 1854458 * None * I was very excited by Sakura-chan’s oil massage ♡ The second round because I had an outburst! After-blow and mouth shot ♡

  • amateur uncensoredfc2
    • 2021-06-06
    51 min

    188HINT-0461 Misaki

  • amateur censoredcreampiebig titshinthint-0461hint0461188hint-0461
    • 2021-06-16
    120 min

    [JYMA-011]If Any Man Approaches Her She Can't Say No - Voluptuous Married Submissive Slut With Big Tits - Her Big Booty And G-Cup Knockers Bouncing While She's Nailed

  • censoredcreampiebig titsJYMAjukujo ha tsurai yobuddha dmanji groupJYMA-011JYMA011jyma00011
    • 2021-06-19
    148 min

    [JUL-620]This Rare Bride With A Beautiful Face Is Finally Ready For Her First Creampie! All Alone For A Sweaty Fuck With A Gorgeous Part-Timer... Hitomi Honda

  • honda hitomi censoredcreampiemature womanJULmadonnakitorune kawaguchiJUL-620JUL620jul00620
    • 2021-07-02
    124 min

    [NKKD-216]Her Husband's Boss Is An Ass Lover... And He's Got His Eye On This Chaste Wife's Perky Booty Yu Shinoda

  • shinoda yu censoredbig titsmature womanNKKDjet eizoNKKD-216NKKD216nkkd00216
    • 2021-07-31
    110 min

    [MEAT-034]Plump Big Butt: H103! A Quiet, Really Pervy Country Girl Who Goes To Tokyo To Date A Sugar Daddy

  • censoreduniformschoolgirlMEATbig the nikumichi mousozokuMEAT-034MEAT034meat00034
    • 2021-08-06
    240 min

    [IPX-705]Superfan House Call Special - Anna Kami Makes Seven Selected Superfans Cum Hard With Her Incredible SEX Skills 15 Loads, 4 Hours

  • anna kami censoredcosplayIPXidea pocketinabartissueIPX-705IPX705ipx00705
    • 2021-08-07
    239 min

    [NASH-552]Special - Extreme Rubbing Of The Fully Ripe Woman With Big Tits

  • censoredcreampiebig titsNASHnadeshikoNASH-552NASH552nash00552
    • 2021-08-16
    73 min

    328HMDN-394 [Miracle Mature Woman] Former Stage Actress Wife 39 Years Old Sns ＃ Wife’S Hcup Big Breasts Grabbed By Sperm Donation And Continuous Seeding Of Direct Shot Of The Pussy. Convulsions Acme To Angry Thick Unequaled Cock Uterus Kiss

  • amateur censoredcreampiebig titshmdnhmdn-394hmdn394328hmdn-394
    • 2021-08-17
    211 min

    [STARS-394]The No.1 Neat And Clean Gravure Idol An Idol Dreams Of Having Sex In The Image Video Age Kanan Amamiya (Overwhelming 4K Video Nookie!)

  • hanan amamiya censoredbig titsSTARSsod createSTARS-394STARS394
    • 2021-08-26
    485 min

    [NHDTB-569]NATURALHIGH Summer Special. Sensitive (Shameful) Big Tits Pervert 2021 Complete Edition. Sex For All 10 Performers. Hard Nipples Version. 2 Volumes, 8 Hours

  • censoredbig titssquirtingNHDTBnatural highkansukeNHDTB-569NHDTB5691nhdtb00569
    • 2021-09-07
    123 min

    FC2PPV 2169953 "Hatsumi Saki" Uncensored Raw Vaginal Cum Shot Video Leaked! 6 / Shave And Shoot Dark Man Hair! Vine Man Full View Shaved Sex! Part 1 2 Hours

  • amateur uncensoredfc2
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-12
    30 min

    FC2PPV 2190571 [Sequel] Very Popular! 18-Year-Old Active Girl ◯ Student Super Slender Beautiful Girl Rika-Chan Latest Work! Make A Swimsuit After School And Shoot A Large Amount Of Facial Cumshots For The First Time In Your Life!

  • amateur uncensoredfc2
    • 2021-09-16
    61 min

    SIRO-4628 [First Shot] [Ripe Naked Body] [Leaking Sigh] A Married Dietitian Who Is Sexless And Craving For Carnal Appearance Appears. Regaining Moisture In The Depleted Horny Hole, The Expression That Devours The Phallus Saying "I Want It Soon &#

  • amateur censoredbig titsmarried womansirosiro-4628siro4628siro-4628
    • 2021-09-16
    62 min

    FC2PPV 2208271 [Complete Amateur 118] JD Ako 20 Years Old, That Beautiful Girl Who Is Almost A Virgin Challenges The Second Sex With The Ban On Appearance! Premium 4K

  • amateur uncensoredfc2
    • 2021-09-18
    157 min

    [ONSG-041]Big Tits Delivery Inaba Ruka

  • inaba censoredcreampiebig titsONSGgeinko pore shongain corporationONSG-041ONSG041onsg00041
    • 2021-09-29
    42 min

    491TKWA-193 Geki Kawa K-Cos 3P Creampie & Facial Cumshot! (Meru Kusumi)

  • amateur censoredcreampieuniformtkwatkwa-193tkwa193491tkwa-193
    • 2021-10-15
    90 min

    [VENX-083]Creampie Life With My Mother-in-law Who I Have Been Longing For During Father"s Absence On An Employee Trip Asaka Tomita

  • asaka tomita censoredcreampiemature womanVENXvenuskanieincest vi nasuVENX-083VENX083venx00083
    • 2021-10-21
    108 min

    485GCB-017 Big Tits! K Cup! !! !! Ena Koume Vs Supporting Role (Mob) Virgin! !! !! [This Date Course: [Lake Kawaguchi] Swan Boat ⇒ Ropeway ⇒ Stroll] Throw The Actress In A Circle! Real Document Gachinko Sex!

  • amateur censoredbig titsamateurgcbgcb-017gcb017485gcb-017
    • 2021-11-11
    148 min

    [RCTD-432]For Women: A Nipple-Rubbing Clinic and Physical Exam

  • akari shinmura yamamoto renka censoredbig titsschoolgirlRCTDrocketroot yamazakiRCTD-432RCTD4321rctd00432
    • 2021-11-13
    115 min

    [HALE-010]Devouring MILFS Infinite Loop Vol. 8 Aika THE Flesh. Slutty Tits And Ass Whipping, Highly Sensitive MILF Comes With One Stroke

  • censoredbig titsamateurHALEhalentino mousouzokuhalentinomom friend eating infinite loopHALE-010HALE010hale00010
    • 2021-11-25
    121 min

    [SUN-036]Nipple Exhibitionism: Going On A Shameful Tour With A Girl With A Small Waist And Beautiful Tits Who Exposes Her Nipples As She Walks Around The Shops

  • harusaki azumi censoredbig titssingle workSUNsunbacon tanakaSUN-036SUN03613sun00036
    • 2021-11-30
    79 min

    451HHH-036 AV First Experience [Saddle Tide Dobadoba] [Tall Slender] [Super Beautiful Girl! ] The Strongest Amateur With A Perfect Style On A Tiny Face! Sex For The First Time In Half A Year, Peeing And Peeing While Climaxing! Obo Girl ＃ 019 (Also An

  • amateur censoredsquirtingamateurhhhhhh-036hhh036451hhh-036
    • 2021-12-02
    75 min

    [REBD-609]Kanan Twinkle Tropical. Kanan Amamiya

  • amamiya hanan censoredsingle workREBDrebeccataiga kosakaiREBD-609REBD609h-346rebd00609
    • 2021-12-03
    148 min

    [ATID-488]Indigo Petals, Anal Edema Of Fallen Shame

  • mika aikawa censoredsingle workATIDattackerskanou hanain madATID-488ATID488atid00488
    • 2021-12-17
    84 min

    355OPCYN-215 Kana (Natsuna Sasaki)

  • amateur censoredamateurbeautiful girlopcynopcyn-215opcyn215355opcyn-215
    • 2021-12-19
    55 min

    229SCUTE-1165 Mitsuha (24) S-Cute Enthusiastic Sex That Begins After Kissing Her Eyes (Mitsuha Higuchi)

  • amateur censoredamateurbeautiful girlscutescute-1165scute1165229scute-1165
    • 2021-12-25
    240 min

    [OKAX-798]When I Asked My Wife"s Mother To Give Me A Blowjob, She Said, "Please Suck My Cock Instead Of My Wife..." 4 Hours

  • censoredmature womanOKAXk m producedick mandokuokazuOKAX-798OKAX798okax00798



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi