jav squirting censored housewife javcensored




FC2HODVMIDEMVSDDASDSHKDAUKSCHRVVEMASPRDFSDSSGVHDTTAWDSTARSJUFEIPXATIDMIAAONEZSSIS

2020-11-13
222 min

[IPX-559]"How Do You Like Me - Bold Or Obedient？" Slender E-Cup Beauty Rio Kuriyama Takes On 6 Sexy Challenges 220 Minutes, 4 Performances

  • rio kuriyama censoredbeautiful girlslutIPXidea pocketusa pyondishIPX-559IPX559ipx00559
    • 2020-11-13
    151 min

    [KBI-046]Dirty Talk With A Hot Married Woman - This Elegant Slut Will Light Your Cock On Fire With Her Wicked Tongue Honoka Yonekura

  • hoika yonekura censoredcreampiemature womanKBIprestigemasarupansakanbiKBI-046KBI046118kbi00046
    • 2020-11-18
    67 min

    [NYH-060]Testing My Theory About The Neighborhood Housewife Who Panty-Flashes Me On Trash Day Being Down To Fuck Kokomi Hoshinaka

  • kozomi hoshinaka censoredmarried womanslutNYHdirectorsdirectorsnyanjiang houseNYH-060NYH0601nyh00060
    • 2020-11-20
    60 min

    [PARATHD-3028]Real Persuasion II

  • censoredamateurblowjobPARATHDparadise tvPARATHD-3028PARATHD3028parathd03028
    • 2020-11-20
    130 min

    [MBM-238]Immersive Feeling Beyond Even VR: Air Sex Real Masturbation, With An Even More Amazing View Than If You Were Actually Doing It Yourself. Lovey-dovey SEX That Is Just Too Erotic!

  • censoredMBMprestigejanhirombmMBM-238MBM238118mbm00238
    • 2020-11-25
    58 min

    [orec-628]みほさん

  • amateur censoredbig titsamateurorecorec-628orec628orec-628
    • 2020-11-26
    135 min

    [RCTD-365]Stop The Clock With Akane, The Colossal Tits Female Wrestler!

  • akane censoredbig titssingle workRCTDrocketkiyoshi miwaRCTD-365RCTD3651rctd00365
    • 2020-12-01
    140 min

    [STARS-305]Makoto Toda - 12 Loads In A Single Day - Sizzling Creampie Day Trip To A Hot Spring

  • makoto toda censoredcreampiebeautiful girlSTARSsod createzaku araiSTARS-305STARS3051stars00305
    • 2020-12-04
    88 min

    [hoi-149]栗山夏(24)

  • amateur censoredbig titsamateurhoihoi-149hoi149hoi-149
    • 2020-12-10
    86 min

    [ant-010]あいちゃん 2(22)

  • amateur censoredamateurblowjobantant-010ant010ant-010
    • 2020-12-17
    176 min

    [ROYD-036]Slut's C***dhood Friend Makes Her Cum So Hard She Trembles! I Never Knew He Was So Hung.... Narumi Hirose

  • narumi hirose censoredsingle workROYDroyalmorikihhh groupROYD-036ROYD036royd00036
    • 2020-12-18
    82 min

    259LUXU-1352 Luxury TV 1341 H-cup dental hygienist with 1 experienced person debuts! !! A glamorous sensitive body that makes you feel too much after having sex for the first time in a long time. Instinct full-throttle obscene sexual intercourse that

  • amateur censoredbig titsamateurluxuluxu-1352luxu1352259luxu-1352
    • 2020-12-24
    240 min

    [SW-747]I Became a Teacher In Order To Have Sex With Cute Female S*****ts! 10

  • censoredbig titsSWswitchSW-747SW7471sw00747
    • 2021-01-10
    79 min

    300MAAN-616 [Exquisite smooth skin x lotion bath x Icharab raw squirrel] Public and private confusion during naughty service! A luxury soap lady who always has love love SEX with the other party! Slimy soap play that watered down many men! !! It melt

  • amateur censoredcreampieamateurmaanmaan-616maan616300maan-616
    • 2021-01-22
    57 min

    [oretd-840]AMASAWA

  • amateur censoredcreampieuniformoretdoretd-840oretd840oretd-840
    • 2021-01-27
    78 min

    FC2PPV 1661906 [Personal shooting / set sale] Young wife who inserts another stick as a reward for herself on her 28th birthday ① & ②

  • amateur uncensoredfc2
    • 2021-02-18
    185 min

    [HUNTA-948]I Thought I Was Going To An Offline Meetup Of Just Guys, But It Was Just Girls And I Was On The Only Guy! I Went To A Hot Party For Game Lovers For The First Time. And Counter To My Expectations, Everyone But Me Was ...

  • censoredcreampieHUNTAhunterkawajirihhh groupHUNTA-948HUNTA948hunta00948
    • 2021-02-21
    58 min

    HEYZO 2466 Pervert Girl Cums With Pee – Mayumi Ninomiya

  • amateur uncensoredcreampieheyzo
    • 2021-02-26
    203 min

    [SABA-679]10 Of The Highest Raking Amateur Babes In Totally Exclusive Footage In This Collector's Edition! Orgasmic Piston-Pounding Dildo Masturbation, All The Way To The Hilt 7

  • censoredamateurSABAskyu shirotoSABA-679SABA679h-244saba00679
    • 2021-02-27
    240 min

    [MCSR-427]Amazing Married Women Get Dirty In Front Of Their Husbands... - 4 Hours

  • takarada monami an sasakura censoredcreampiebig titsMCSRbig morkaljiro kanekomascottMCSR-427MCSR42757mcsr00427
    • 2021-03-19
    84 min

    [ETQR-207](A Daydream Fantasy Re-Enactment Drama) I Was Booked Into The Same Room With My Favorite Lady Boss At The Love Hotel Natsu Tojo

  • natsu tojo censoredcreampieuniformETQRerotic timeETQR-207ETQR207h-1186etqr00207
    • 2021-03-24
    57 min

    494SIKA-069 Fururi Yankee Daughter Is Covered With Sperm In 4P

  • amateur censoredcreampieschoolgirlsikasika-069sika069494sika-069
    • 2021-03-30
    67 min

    491TKWA-078 A delicate little girl is tossed by ugly men in uniform cosplay!

  • amateur censoreduniformamateurtkwatkwa-078tkwa078491tkwa-078
    • 2021-04-02
    118 min

    [BBAN-320]Horny Modern Punk Girl At An All Girls School Finds A Way To Release Her Sexual Frustration I've Got It! I Can Just Fuck Other Girls!

  • tianhe uzuki liana censoredlesbianBBANbibianBBAN-320BBAN320bban00320
    • 2021-04-05
    77 min

    376H-622 Bondage Innocent Uniform Girls ●● Squid With SEX! ＃ Hanane ＃ 18 years old

  • amateur censoredcreampieuniformhh-622h622376h-622
    • 2021-04-10
    138 min

    [EKDV-658]My Stepsister Took My Virginity... My Sweet Stepsister Offered To Teach Me How To Have Sex After I Got My First Girlfriend Asuka Momose

  • momose asuka censoredcreampiesisterEKDVcrystal eizoharuo miyafujie kissEKDV-658EKDV658ekdv00658
    • 2021-04-14
    479 min

    [HHF-011]Sexy Love Chain From Bottom To Top! Energetic Bunk Bed Sex Moving Up And Down Highlights

  • censoredsisterHHFhunterhhh groupHHF-011HHF011hhf00011
    • 2021-04-16
    54 min

    230OREC-739 Ai

  • amateur censoredcreampiebig titsorecorec-739orec739230orec-739
    • 2021-04-18
    120 min

    [NEWM-001]My Step Mom's Ass In And Out Full View Sex With Step Mother Part 4 Mari Aoi

  • mari aoi censoredmature womansingle workNEWMglobal media entertainmentkikujiro akabanenewmomNEWM-001NEWM001newm00001
    • 2021-04-19
    43 min

    475SKCK-029 Churin 2

  • amateur censoredanalamateurskckskck-029skck029475skck-029
    • 2021-05-06
    64 min

    SIRO-4476 [First shot] [Slender sensitive body] [Superb dirty gal] A slender gal goddess with infinite libido descends. The instinct bare SEX of the erotic goddess who repeats ascension many times faithfully to her desire is a must-see. AV applicatio

  • amateur censoredamateursirosiro-4476siro4476siro-4476
    • 2021-05-09
    97 min

    345SIMM-641 Amaenbo J ○, who has the best hugging body, is just crazy about Hajimete’s house date SEX! !! "I’m thrilled with just my boobs … ///" "Ahhhhhhh …! Kimochii …" The second round of cow costumes i

  • amateur censoredcreampiebig titssimmsimm-641simm641345simm-641
    • 2021-05-24
    47 min

    FC2PPV 1834656 [Personal shooting, vaginal cum shot, pt off for a limited time] 33-year-old child and wife, who should have rubber, could not stand being rubbed with raw cock and accepted raw insertion …

  • amateur uncensoredfc2
    • 2021-06-15
    67 min

    10musume 061521_01 A beautiful aromatherapy instructor healed my heart and dick Nao Furuta

  • amateur uncensored10musume
    • 2021-07-02
    61 min

    SIRO-4540 [First shot] [Tohoku beauty with beautiful breasts] A fair-skinned beauty from Tohoku. She spends fulfilling days, but the devil is in her sexual desire that is increasing year by year .. AV application on the net → AV experience shooting 1

  • amateur censoredamateursirosiro-4540siro4540siro-4540
    • 2021-07-03
    46 min

    FC2PPV 1900625 [Individual shooting] Baby-faced beautiful girl Actually Yarimoku J system Momentum raw Paco without reason [Gonzo, amateur, vaginal cum shot]

  • amateur uncensoredfc2
    • 2021-07-05
    88 min

    FC2PPV 1904383 980 yen! The best masterpiece! !! [Director’s role] I’m flirting after dating Lori ♪ Cowgirl Saddle tide & self tide facial cumshot! Continuous convulsions climax with Ahegao Oho voice! !! Lori Big Breasts Moko-chan Chapte

  • amateur uncensoredfc2
    • 2021-07-06
    51 min

    188HINT-0464 Misaki

  • amateur censoredcreampiemarried womanhinthint-0464hint0464188hint-0464
    • 2021-07-06
    31 min

    493NAEN-082 Sleep ○ Fuck! ？？ Sleeping Gonzo! ？？ Minimum Saffle and Good Morning Sex & Creampie Miho Sakasaki

  • amateur censoredamateurbeautiful girlnaennaen-082naen082493naen-082
    • 2021-07-22
    91 min

    STH-002 Kazumi

  • amateur censoredbig titsamateursthsth-002sth002sth-002
    • 2021-07-30
    69 min

    [hhsi-007]マオ(25)

  • amateur censoredbig titsamateurhhsihhsi-007hhsi007hhsi-007
    • 2021-07-31
    115 min

    [KTB-048]Meaty Appartment - Part-Timer Housewife OL Miss Yurika"s ( G Cup) Body Sharehouse - Aira Hatta

  • yurika censoredbig titssingle workKTBkahanshin tigers mousozokukahanshin tigersKTB-048KTB048ktb00048
    • 2021-08-06
    132 min

    [DASD-901]Uniform Boy Hikari Tamaki

  • hikari tamaki censoredbeautiful girlsingle workDASDdasmasaki naoDASD-901DASD901dasd00901
    • 2021-08-12
    123 min

    [IESP-684]Karen Asahina Lesbians Unleashed - I Fell In Love With My Step-cousin -

  • karen asahina kira rin censoredlesbiandramaIESPie nergykiku riniespIESP-684IESP6841iesp00684
    • 2021-09-01
    73 min

    326NKD-001 [Creampie Tracking 24 O’Clock] G Beautiful Big Breasts Reasonable Mask Beauty Cums In The Vagina Back Gun Thrust Piston & Creampie 2 Barrage! !! [Case: 01 / Field Survey Of Support Activities]

  • amateur censoredcreampiebig titsnkdnkd-001nkd001326nkd-001
    • 2021-09-09
    167 min

    [SW-799]Looking Down At Girl"s Panties. Just Giving A Sneaky Look To See Her Amazing Panties Even If It Means Getting Caught! She Gets Super Turned On From Getting Checked Out And Now She Wants To Get Lewd!

  • censoredschoolgirlSWswitchraito fuji makotoswitch hibinoSW-799SW7991sw00799
    • 2021-09-11
    211 min

    [BAZX-305]Full POV x Total Domain: Beautiful Y********l In Knee High Uniform vol. 001

  • censoredbeautiful girlBAZXk m producetodobazookaBAZX-305BAZX305bazx00305
    • 2021-09-29
    58 min

    491TKWA-192 H Cup Big Tits J ● And 3P Cum Inside! (Riho Takahashi)

  • amateur censoredcreampiebig titstkwatkwa-192tkwa192491tkwa-192
    • 2021-09-30
    83 min

    355OPCYN-185 Kanna (Shiori Hirai)

  • amateur censoredamateuropcynopcyn-185opcyn185355opcyn-185
    • 2021-10-16
    122 min

    [SCD-198]She"s Good At Getting Fucked A Bus Tour Guide In A Miniskirt Arisa Hanyu

  • arisa hanyu arisu hanyu censoredmature womansingle workSCDrubykatsumoku saburousecret rubiSCD-198SCD198scd00198
    • 2021-10-17
    121 min

    300MIUM-757 [Super Idol Raw Sex] Rent A Hidden Idol Active Jd As Her! Completely Rec The Whole Story That Was Spoiled Up To The Originally Prohibited Erotic Acts By Persuading! !! After Enjoying A Park Date & A Secret Blowjob In A Tent, Erokos Sex

  • amateur censoredcreampieamateurmiummium-757mium757300mium-757
    • 2021-11-06
    82 min

    300NTK-650 [A Miracle Combination Of A Beautiful Girl With A Half-Hearted Ass And A Tall God Boyne! !! ] [Last This Year! ？？ The Opening Of The Summer Festival BBQ Gangbang! ？？ ] [A Wonderful Young Nympho Competition Student Naka Sex! !! ] The Best S

  • amateur censoredcreampiesquirtingntkntk-650ntk650300ntk-650
    • 2021-11-11
    55 min

    413INST-182 [Married Woman 5P Orgy Individual Shooting 3] Oil Puru Puru W Big Breasts I Cup Two Married Women Young Penis A Bikini Wife Who Goes Crazy For Deliciously

  • amateur censoredcreampiebig titsinstinst-182inst182413inst-182
    • 2021-11-13
    115 min

    [DDHH-033]A Barely Legal Babe In Chains Rika Aimi

  • rumi tadami censoredbig titsdeepthroatDDHHdogmahidekiDDHH-033DDHH033ddhh00033
    • 2021-11-19
    225 min

    [HUNTB-143]The Obvious Panty Line From Her Tight Dress Gives Me A Raging Boner!! 2 You Can Totally See All The Neighbor"s Panty Lines Because They All Wear Thin, Tight Dresses

  • censoredcreampielingerieHUNTBhunterkoichi davidsonhhh groupHUNTB-143HUNTB143huntb00143
    • 2021-12-04
    120 min

    [GVH-328]A Lewd Housewife Who Comes At Me WIth No Bra Or Pants Has Moved In Next Door! Riona Hirose

  • rio hirose censoredslutsingle workGVHglory questkisakura kabinGVH-328GVH328gvh00328



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi