javcensored beautiful girl high vision sister creampie




FC2APODGMEMDTTHMNROYDMIDVSSNIBLKSQTESPRDPPPDSANVEMACAWDNATRDASDLULUNNPJABWJUL

2020-09-04
44 min

[ETQR-153](Daydream POV Sex) At This Reflexology Salon, You'll Be Serviced By A Little Stepsister Who Loves Her Big Stepbrother So Much, You'll Get To Fuck Her Brains Out Ichika Matsumoto

  • ichika matsumoto censoredcreampieuniformETQRerotic timeETQR-153ETQR153h-1186etqr00153
    • 2020-09-04
    53 min

    [ETQR-155](Daydream POV Sex) At This Reflexology Salon, You'll Be Serviced By A Little Stepsister Who Loves Her Big Stepbrother So Much, You'll Get To Fuck Her Brains Out Shuri Atomi

  • atomi shuri censoredcreampieuniformETQRerotic timeETQR-155ETQR155h-1186etqr00155
    • 2020-09-04
    67 min

    [ETQR-157](Daydream POV) Overly Obsessive Stepsister's Fierce Attempts To Make Advances! Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlETQRerotic timeETQR-157ETQR157h-1186etqr00157
    • 2020-09-04
    76 min

    [ETQR-158](Proper POV) Stepsister Who Is Madly In Love With Her Stepbrother's Huge Cock Nagi Aiiro

  • indigo nagi censoredcreampieuniformETQRerotic timeETQR-158ETQR158h-1186etqr00158
    • 2020-07-10
    120 min

    [MDTM-650]The Story Of An Orgasmic Prematurely Ejaculating Sensual Little Stepsister And Her Babymaking Day On Her Ovulation Day Momo Hazuki ACT. 009

  • hazuki peach censoredcreampieuniformMDTMuchu kikakutodoMDTM-650MDTM650h-585mdtm00650
    • 2020-07-09
    129 min

    [EKDV-635]My Little Stepsister Has A Cute Smile, And Whenever Our Eyes Meet, She Silently Lusts For My Body, So We Spent Our Holiday Together, Alone, Privately Chiharu Sakurai

  • chiharu sakurai censoredcreampiebeautiful girlEKDVcrystal eizoharuo miyafujie kissEKDV-635EKDV63549ekdv00635
    • 2020-07-04
    166 min

    [BF-611]After I Got Into A Fight With My Wife, My Wife's Young Sister Pretended To Comfort Me, And Instead Lured Me To Temptation, And As I Could No Longer Resist Her Charms, I Creampie Fucked Her, Over And Over Again. Rei Kuruki

  • satoshi kuruki censoredcreampiebeautiful girlBFbefreeroku yonBF-611BF611bf00611
    • 2020-06-26
    70 min

    [ETQR-144]Daydream POV - An Obsessive Stepsister Just Wants To Be Loved! - Momo Hazuki

  • hazuki peach censoredcreampiebeautiful girlETQRerotic timeETQR-144ETQR144h-1186etqr00144
    • 2020-06-04
    140 min

    [EKDV-632]My Little Stepsister Is An Adult Video Actress! When My Dad Got Remarried, My New Little Stepsister Is A Beautiful Girl Who Had Performed In A Cosplay Adult Video! Aoi Kururugi

  • aoi kururugi censoredcreampiecosplayEKDVcrystal eizoharuo miyafujie kissEKDV-632EKDV63249ekdv00632
    • 2020-05-30
    63 min

    [ETQR-141][Daydream POV] Obsessed Stepsis's Intense Acts Of Sluttery! Aida Usagi

  • aika usagi censoredcreampiebeautiful girlETQRerotic timeETQR-141ETQR141h-1186etqr00141
    • 2020-05-23
    119 min

    [HND-840]My Girlfriend's Little Sister Loves Me Too Much, So Now We're Secretly Having Babymaking Sex Together Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlHNDhon nakausa pyonHND-840HND840hnd00840
    • 2020-05-17
    129 min

    [IKEP-007]My Friend Really Pisses Me Off, So I Took His Precious Little Sister And Put Her Under Brainwashing H*******m For 3 Months And Turned Her Into A Creampie Cum Bucket, And Here's The Video Record To Prove It (Supervised By The Shibuya H**

  • abe mikako censoredcreampieschoolgirlIKEPla porno daydreamersvagmanIKEP-007IKEP007ikep00007
    • 2020-05-16
    69 min

    [ETQR-134]My Excessively Emotionally Disturbed Little Stepsister Is Cumming At Me With Sexual Desires! Nozomi Arimura

  • arimura nozomi censoredcreampieuniformETQRerotic timeETQR-134ETQR134h-1186etqr00134
    • 2020-05-16
    115 min

    [ROYD-006]Usually My Little Stepsister Is A Cute Plain Jane With A Big Ass, But Then She Started Showing Off The Total Domain Of Her Pussy, And By The Time I Realized What Was Happening, I Had Creampie Fucked her. Akari Neo

  • akari neo censoredcreampiebeautiful girlROYDroyalcognac kaminohhh groupROYD-006ROYD006royd00006
    • 2020-05-15
    120 min

    [MDTM-634]The Story Of Ovulation Day Babymaking Sex With A Cum-Crazy Prematurely Ejaculating Sensual Little Stepsister Nozomi Arimura ACT.007 007

  • arimura nozomi censoredcreampieuniformMDTMuchu kikakutodoMDTM-634MDTM634h-585mdtm00634
    • 2020-04-19
    120 min

    [HND-826]My Girlfriend's Sister Loves Me So Much, She Wants Me To Get Her Pregnant - Akari Neo

  • akari neo censoredcreampieblowjobHNDhon nakausa pyonHND-826HND826hnd00826
    • 2020-04-19
    120 min

    [HND-824]Seeing That Girl I Knew As A K*d At A Creampie Soapland, Rei Kuruki

  • satoshi kuruki censoredcreampiebeautiful girlHNDhon nakacontour styleHND-824HND824hnd00824
    • 2020-04-18
    48 min

    [HHKL-025]A Totally Sexy Encounter With A Girl Who Got Kicked Out By Her Boyfriend With Nothing But A Towel! I Made Eye Contact With A Girl Who Looked Like She Needed Help...

  • censoredcreampiebig titsHHKLhuntercognac kaminohhh groupHHKL-025HHKL025hhkl00025
    • 2020-04-11
    115 min

    [MUDR-107]Step-Sister With Monstrous Sex Drive Spends Three Days Fucking Her Step-Brother Over And Over In His Room Before Moving Away To A Boarding School For The Spring Term: Erika Arimura

  • eri arimura censoredcreampiebeautiful girlMUDRmukuMUDR-107MUDR107mudr00107
    • 2020-04-10
    119 min

    [MDTM-627]I'm Having Sex With My Younger Step-Sister Every Day. Step-Siblings Get Along So Well That They Film Themselves Fucking Each Other For Masturbation Material. Ai Kawana vol. 002

  • ai kawana censoredcreampieuniformMDTMmedia stationtodouchu kikakuMDTM-627MDTM62761mdtm00627
    • 2020-04-10
    120 min

    [MDTM-626]Risky Sex With My Sensitive Stepsister While She's Ovulating - Azusa Misaki 006

  • misaki azusa censoredcreampieuniformMDTMmedia stationtodouchu kikakuMDTM-626MDTM62661mdtm00626
    • 2020-03-31
    58 min

    [ETQR-128]An Obsessive Stepsister Desperate To Be Loved! - Azusa Misaki

  • misaki azusa censoredcreampiebeautiful girlETQRerotic timeETQR-128ETQR128h-1186etqr00128
    • 2020-03-27
    300 min

    [EQ-511]Low Quality Amateur Picking Up Girls Special Please! Can We Have Intercrural Sex？ Girl Gets Wet Without Knowing When a Rock-Hard Cock Rubs Directly Down There Going Raw Into a Slippery Vagina 15 Girls 5 Hours 3

  • censoredcreampiebig titsEQbullittpretty honey brittEQ-511EQ511h-100eq00511
    • 2020-03-21
    177 min

    [HND-819]I Found A Video Online Of My Female Friend Getting Fucked And Creampied By Guys I Don't Know, And They Even Made Her Cum - Akari Mitani

  • mitani akari censoredcreampiebeautiful girlHNDbooknao masakiHND-819HND819hnd00819
    • 2020-03-21
    119 min

    [HND-814]My Girlfriend's Little Sister Loves Me Too Much, So We Secretly Started Making Babies Urara Kanon

  • hanaoto urara censoredcreampiebeautiful girlHNDbookusapyonHND-814HND814hnd00814
    • 2020-03-13
    144 min

    [SCPX-386]The Beautiful Girl Next Door Has A Fight With Her Boyfriend And Gets Thrown Out In Her Pajamas - It's Cold Outside So I Let Her Into My Place - Now She's In My Room, Barely Dressed, And I Don't Know If I Can Control Myself...

  • censoredcreampiebig titsSCPXscoophasshimousouzokuSCPX-386SCPX386h-565scpx00386
    • 2020-03-13
    118 min

    [VRTM-489]"Stop Fighting!" Stepbrothers And Stepsisters Nurturing Forbidden Love Pretend To Fight While Hiding Behind Their Parents' Backs And Withholding Their Screams During Super-Dangerous Creampie Sex! 2

  • yui nagase toua kotone censoredcreampieuniformVRTMv r produceeigo mochizukiVRTM-489VRTM489h-910vrtm00489
    • 2020-03-13
    120 min

    [MDTM-613]My Stepsister's Sex Drive Is Way Too Strong. Vol.001 Riana Yuzuki

  • uzuki liana censoredcreampieuniformMDTMmedia stationtodouchu kikakuMDTM-613MDTM61361mdtm00613
    • 2020-03-10
    63 min

    [ETQR-123]Daily Life Babymaking With A Cute Younger Step-sister In Heat During Her Ovulation Day: Liana Yugetsu

  • uzuki liana censoredcreampiebeautiful girlETQRerotic timeETQR-123ETQR123h-1186etqr00123
    • 2020-02-22
    131 min

    [DASD-639]I Fucked And Creampied My Stepsister For Two Days Straight While Our Parents Were Away - Kanon Ichikawa

  • kanon ichikawa censoredcreampiebeautiful girlDASDdassasagiriDASD-639DASD639dasd00639
    • 2020-02-22
    121 min

    [HND-796]I Get Revenge On My Stepsister Who Always Treats Me Like A Creep By Covering Her Face In Sweat, Spit, And Cum - Yui Nagase

  • yui nagase censoredcreampiebeautiful girlHNDbooktanaka baconHND-796HND796hnd00796
    • 2020-02-14
    120 min

    [MDTM-608]The Ovulation Day Babymaking Story Of A Prematurely Ejaculating Orgasmic And Sensual Little Stepsister Mai Yahiro ACT. 005

  • mai yahiro censoredcreampieuniformMDTMmedia stationtodouchu kikakuMDTM-608MDTM60861mdtm00608
    • 2020-02-11
    120 min

    [KTRA-191]I Creampied My Big-Titted Step Sister Rui Hiragi

  • scolding censoredcreampiebig titsKTRAk tribeno directorKTRA-191KTRA191h-094ktra00191
    • 2020-02-07
    159 min

    [YMDD-181]I Spied On My Sensitive Stepsister With Big Tits Getting Fucked - Now I Won't Be Satisfied Until She Lets Me Fuck Her Too - Nene Tsukimiya

  • nene tsukimiya censoredcreampiebig titsYMDDmomotaro eizohimu lockwakamomoYMDD-181YMDD181ymdd00181
    • 2020-01-31
    179 min

    [SKMJ-086]A Former Local Idol - Currently Working At A Tapioca Tea Shop - Big Sexy G-Cup Tits - Renka Yamamoto Makes Her Porno Debut

  • yamamoto renka censoredcreampiebig titsSKMJred face girlyosukeSKMJ-086SKMJ086h-1324skmj00086
    • 2020-01-31
    60 min

    [ETQR-122]An Obsessive Stepsister Who Just Wants To Be Loved! - Mai Yahiro

  • mai yahiro censoredcreampiebeautiful girlETQRerotic timeno directorETQR-122ETQR122h-1186etqr00122
    • 2020-01-14
    122 min

    [KTRA-181]Creampie My Step-Sister With Colossal Tits: Rio Ishihara

  • ishihara censoredcreampiebig titsKTRAk tribeKTRA-181KTRA181h-094ktra00181
    • 2020-01-14
    120 min

    [KTRA-183]A Girl With Small Tits Gets Creampied - Yui Nagase

  • yui nagase censoredcreampiebeautiful girlKTRAk tribeKTRA-183KTRA183h-094ktra00183
    • 2020-01-01
    240 min

    [BUR-538]Stepsister Fuck 4 Hours -I Fucked My Stepbro-

  • censoredcreampiebeautiful girlBURglay zburst graceBUR-538BUR53812bur00538
    • 2019-12-28
    157 min

    [JUKF-033]Forbidden Relationships - This Stepbrother And Stepsister Have Sex At Least Twice A Week While Their Parents Aren't Looking - Haruna Kawakita

  • hebei haruna censoredcreampiebig titsJUKFjumpdeep sea jumpJUKF-033JUKF033h-227jukf00033
    • 2019-12-24
    128 min

    [STARS-170]These Piano-Playing Sisters Were Targeted By My Neighbor, A Sexually Monstrous Middle-Aged Dirty Old Man Makoto Toda Lulu Arisu

  • makoto toda have censoredcreampiebeautiful girlSTARSsod createryo inugamisod starSTARS-170STARS1701stars00170
    • 2019-12-19
    119 min

    [HND-770]My Girlfriend's Sister Is Obsessed And Wants To Have My Baby! Kanon Kanade

  • kanon kanon censoredcreampiebeautiful girlHNDhon nakausa pyonHND-770HND770hnd00770
    • 2019-12-13
    119 min

    [MDTM-582]Making Babies With Early Cumming Sensitive Stepsister Ruka Aise ACT. 004

  • ruka aise censoredcreampieuniformMDTMmedia stationtodouchu kikakuMDTM-582MDTM58261mdtm00582
    • 2019-12-10
    480 min

    [KTRA-176]Beautiful Stepsister 10 Girls Back To Back Fucking 8 Hours 2 Disc Set

  • censoredcreampiebeautiful girlKTRAk tribeKTRA-176KTRA176h-094ktra00176
    • 2019-12-10
    121 min

    [KTRA-173]Tiny-Breasted Stepsister Creampie Hataru Shinogawa

  • firefly oshinogawa censoredcreampieuniformKTRAk tribeKTRA-173KTRA173h-094ktra00173
    • 2019-12-10
    118 min

    [KTRA-174]Small Tits Slender Stepsister Creampie Kanon Momoha

  • hanaba kanon censoredcreampiebeautiful girlKTRAk tribeKTRA-174KTRA174h-094ktra00174
    • 2019-11-17
    117 min

    [HND-748]My Girlfriend Loves Me So Much, We Secretly Started Having Babymaking Sex Together Nao Jinguji

  • jinguji temple nao censoredcreampiebig titsHNDhon nakausa pyonHND-748HND748hnd00748
    • 2019-11-12
    120 min

    [KTRA-167]Smooth-Skinned Stepsister Creampies - Kotone Toua

  • toua kotone censoredcreampiebeautiful girlKTRAk tribeKTRA-167KTRA167h-094ktra00167
    • 2019-11-12
    116 min

    [KTRA-168]Small Yet Busty Girl Creampie Emi Sakuma

  • emi sakuma censoredcreampiebig titsKTRAk tribeKTRA-168KTRA168h-094ktra00168
    • 2019-11-10
    139 min

    [BACN-012]An Absolute Little Devil Policy How A New Stepbrother And Sister Want To Enjoy Orgasmic Cock Sex Yui Nagase

  • yui nagase censoredcreampiebeautiful girlBACNbaltanspilma boycandyBACN-012BACN012bacn00012
    • 2019-11-09
    119 min

    [IPX-404]A Beautiful Elder Sister Type Who Is Luring Me To Whispering Babymaking Dirty Talk Creampie Temptation Tsumugi Akari

  • akari tsumugi censoredcreampiebeautiful girlIPXidea pocketsugawaratissueIPX-404IPX404ipx00404
    • 2019-11-08
    119 min

    [MDTM-575]The Story Of My Babymaking Lovemaking With A Prematurely Ejaculating Sensual Little Stepsister Tsugumi Morimoto ACT.003 003

  • tsugumi morimoto censoredcreampiebeautiful girlMDTMmedia stationtodouchu kikakuMDTM-575MDTM57561mdtm00575
    • 2019-11-01
    118 min

    [ONEZ-211]My Stepsister Is A My Private Service Maid Emi Kawakita vol. 003

  • emi kawakita censoredcreampieblowjobONEZprestigetodoonezONEZ-211ONEZ211118onez00211
    • 2019-10-25
    52 min

    [OTIM-004][For Streaming Editions] A Bad Girl Maid Provides Babymaking Hospitality Reira Hazuki

  • hazuki leila censoredcreampiebeautiful girlOTIMprestigeone timeOTIM-004OTIM004118otim00004
    • 2019-10-25
    248 min

    [MDTM-571]Hikaru Minazuki Best Hits Collection 4 Hours

  • hikaru minazuki censoredcreampieschoolgirlMDTMmedia stationuchu kikakuMDTM-571MDTM57161mdtm00571
    • 2019-10-23
    54 min

    [ETQR-104]Obsessive Stepsister's Fierce Courtship! Tsugumi Morimoto

  • tsugumi morimoto censoredcreampiebeautiful girlETQRerotic timeETQR-104ETQR104h-1186etqr00104



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi