javcensored censored shame high vision




FC2IPXONEZNACXSQTEADNWAAAVEMAAWDNACRPREDSHKDSDABHNDAUKSATIDMEYDKBIMVSDMIAAAMBI

2019-12-20
47 min

[SHYN-071]Hard Vibrations - Ecstick Twist - A Soft On Demand Staff Member Suddenly Gets Invited To Play With Sex Toys - Yui Nakanishi, SOD Researcher

  • nakanishi yui censoredsingle workSHYNsod createy 10432sod female employeeSHYN-071SHYN0711shyn00071
    • 2019-12-19
    119 min

    [JUL-084]Driven Crazy By A Man I Don't Want... Ai Mukai

  • ai mukai censoredmature womansingle workJULmadonnajo asagiriJUL-084JUL084jul00084
    • 2019-12-19
    227 min

    [LHTD-001]Challenge A Big Vibrator On A Timer! - Miori, Yurina, Sakura

  • miori hara yurina tenki censoredLHTDocean bookslight houseLHTD-001LHTD001171lhtd00001
    • 2019-12-15
    129 min

    [DBER-048]Women Get Fucked By A Machine - Brand New Edition - 8 Women Become Prey To The Pleasure Machine That Makes Them Cum

  • mika aikawa iku kuroki censoredbdsmDBERbabyentertainmentred babeDBER-048DBER048dber00048
    • 2019-12-15
    125 min

    [DDT-626]Deep Throat Monster Azusa Misaki

  • misaki azusa censoredcreampiedeepthroatDDTdogmatohjiroDDT-626DDT626ddt00626
    • 2019-12-14
    229 min

    [ATOM-395]Amateurs Only! Win The Big Cash Prize! Find The Remote For The Remote-Controlled Vibrator 2

  • censoredATOMatomphallus dinohhh groupATOM-395ATOM395atom00395
    • 2019-12-14
    196 min

    [OYC-295]Innocent High S*********ls In Knee-High Socks Get Broken In By Their Teachers

  • censoredschoolgirlOYCoyashoku.companyartesiahhh groupOYC-295OYC295oyc00295
    • 2019-12-13
    150 min

    [C-2482]Please Fuck My Wife Her Name Is Natsumi (28 Years Old) 83

  • censoredCgogostakeshi karakigogo s coreC-2482C2482140c02482
    • 2019-12-13
    197 min

    [SCPX-382]"Since You Fucked My Wife, Let Me Fuck Yours!!" Revenge Cuckold In Front Of The Husband

  • censoredcreampieSCPXscoophasshimousouzokuSCPX-382SCPX382h-565scpx00382
    • 2019-12-12
    244 min

    [NHDTB-345]Natural High Year End Special Hotel Groping 7 Creampie SP

  • censoredcreampiebig titsNHDTBnatural highitaka smith rimpounderNHDTB-345NHDTB3451nhdtb00345
    • 2019-12-10
    123 min

    [EQ-492]Secret Hot Pranks Inside The Futon "Hey!？ My Boyfriend Is Going To Catch Us If We Keep Doing This!" She Got Fucked By Her Boyfriend's Friend And Now She's Enjoying Serious Raw Sex! 2

  • censoredcreampiebig titsEQbullittshuzo kuriyamaitazuraEQ-492EQ492h-100eq00492
    • 2019-12-10
    138 min

    [EQ-495]I Ordered A Deliver Health Call Girl And An Acquaintance Of Mine Came Over, And It Got Really Uncomfortable! Usually There Would Be No Way I Could Go Through With It, But She Said To Me, "Since You Already Paid..." She Was So Thoughtf

  • censoredbig titsamateurEQbullitttakumi midorishameEQ-495EQ495h-100eq00495
    • 2019-12-10
    138 min

    [STARS-165]No Place Left Unlicked In Close Contact Fuck Mahiro Tadai

  • mahiro yui censoredbeautiful girlsingle workSTARSsod createhirokoji osakisod starSTARS-165STARS1651stars00165
    • 2019-12-07
    240 min

    [HJMO-421]Public Shame The Nude Art Model The Sketch Class Where You Absolutely Must Never, Ever Move A Muscle! She's Getting Her Pussy And Her Legs Spread Wide Open And As Everyone Stares At Her, Her Cunt Starts To Become Super Moist And Wet And

  • censoredcreampiebig titsHJMOhajime kikakuhajimeHJMO-421HJMO421hjmo00421
    • 2019-12-07
    211 min

    [HJMO-420]The 7th Best Little Sister Grand-Prix No Panties Allowed, If You Get A Sweat Stain, You Lose The Big Vibrator Endurance Battle

  • censoredsquirtingHJMOhajime kikakuHJMO-420HJMO420hjmo00420
    • 2019-12-06
    56 min

    [SHYN-068]Face Sitting Silent Hot Water Pouring! SOD Female Employee New Game Planning Department

  • shingo akahori young suzuran censoredbukkakeSHYNsod createsoran kobayashisod female employeeSHYN-068SHYN0681shyn00068
    • 2019-12-06
    31 min

    [SHYN-069]Serious Semen Collection! SOD Female Employee New Game Strategy Department

  • chiho kawai nagasawa summer love censoredSHYNsod createsoran kobayashisod female employeeSHYN-069SHYN0691shyn00069
    • 2019-12-01
    240 min

    [BBACOS-022](Shame) Old Lady Cosplay! (BBA) These Old Housewives Were Dressed As Sailor Warriors And Put To Shame (Creampie Sex)

  • mizuki and good amami bookmark censoredcreampieamateurBBACOSplumpostingshirouto only plumBBACOS-022BBACOS022h-113bbacos00022
    • 2019-12-01
    131 min

    [JMTY-018]Free Pussy File 02 - Rin, 20 Years Old: An Incredibly Sensitive Amateur Who Can't Say No To Deep Throat And Creampie

  • censoredcreampieamateurJMTYteacher mousouzokuJMTY-018JMTY018jmty00018
    • 2019-12-01
    289 min

    [DKSB-028]Amateur Girls Masturbate With A Dildo For The First Time On Camera - It Makes Them Feel So Good That They Get Desperate For A Real Cock Inside Them! - 290 Minutes

  • censoredamateurDKSBoffice k sk s bestDKSB-028DKSB02836dksb00028
    • 2019-11-30
    94 min

    [RD-966]A Fifty-Something Mature Woman Who Gets Wet With Shame This Kind And Gentle Stepmom Is Caring For Her Impotent, Depressed Son... This Married Man From The Neighborhood Came To Talk With This Horny Housewife From Osaka About Her Concerns...

  • madoka karasuma yuri hoshino censoredamateurmature womanRDatena eizoukatsuya ichiharaathenaRD-966RD966149rd00966
    • 2019-11-30
    239 min

    [HUNTA-689]"No! Please Don't Touch My Nipples Like That... I... It... Makes Me Feel, So Good..." While Getting A Physical Examination, She Had Her Nipples Touched Over And Over Again, And While All The Other Girls In Class Watched...

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-689HUNTA689hunta00689
    • 2019-11-30
    127 min

    [RD-965]A Showa Filthy Sensual Drama A Hungry Country Wife Is Sucking On The Cock Of The Village Chief... A Neat And Clean Teacher Who Came To Visit One Of Her Students Accidentally Flashed Her Pussy To Her Pupil's Father, And...

  • rieko hiraoka nanako takamiya censoredamateurmature womanRDatena eizoukyosuke murayamaathenaRD-965RD965149rd00965
    • 2019-11-30
    115 min

    [RD-967]The Excitement Of A Sensual Drama This Father-In-Law Is having Creampie Sex With A Son's Wife, Knowing That She Wants A Baby This Fifty-Something Wife Is Having A Love Affair With Her Husband's Employee, Even When He's Still In Th

  • kyoko kubo yuko yokoyama censoredamateurmature womanRDatena eizoukyosuke murayamaathenaRD-967RD967149rd00967
    • 2019-11-27
    55 min

    [OKYH-048]Tamaki (22), Approximately C-Cup - A College Girl We Found At A Hot Spring - Would You Enter The Men's Bath Wearing Just A Towel？

  • censoredamateurOKYHsod createchain soushowing their faces shy amateursOKYH-048OKYH0481okyh00048
    • 2019-11-27
    63 min

    [OKYH-046]20-Year-Old Mai Is A College Girl With At Least D-Cups Tits Who We Discovered At Izu Nagaoka Hot Spring Why Not Take A Hot Bath With The Boys While Wearing Nothing But A Towel？

  • censoredamateurOKYHsod createchain soushowing their faces shy amateursOKYH-046OKYH0461okyh00046
    • 2019-11-27
    64 min

    [OKYH-047]21-Year-Old Karina Is A College Girl With At Least D-Cups Tits Who We Discovered At Izu Nagaoka Hot Spring Why Not Take A Hot Bath With The Boys While Wearing Nothing But A Towel？

  • censoredamateurOKYHsod createchain soushowing their faces shy amateursOKYH-047OKYH0471okyh00047
    • 2019-11-23
    222 min

    [CLUB-588]巨乳水着ギャルばかりを狙う海の家ナンパエステ17

  • censoredbig titsCLUBhentai gentleman clubCLUB-588CLUB588club00588
    • 2019-11-22
    120 min

    [NEM-020]Genuine Abnormal Sex A Fifty-Something Stepmother And Stepson Chapter Eight Abnormal Daily Life With An Obedient Skinny Stepmom Maki Tominaga

  • maki tominaga censoredcreampiemature womanNEMglobal media entertainmentyayoi nakanonewmomNEM-020NEM020143nem00020
    • 2019-11-22
    120 min

    [NEM-021]Genuine Abnormal Sex A Forty-Something Stepmama And Her Stepson Chapter Four A Horny Stepmom Who Eases Her Loneliness By Using Her Stepson Yumi Kazama

  • kazama yumi censoredcreampiebig titsNEMglobal media entertainmentyayoi nakanonewmomNEM-021NEM021143nem00021
    • 2019-11-22
    121 min

    [XRW-784]The Stepdaughter She Was Fucked By A Panythose-Loving Father-In-Law And Her Crazy Big Brother-In-Law Kotone Toa

  • toua kotone censoredcreampiebeautiful girlXRWreal workshideki hormonreal real worksXRW-784XRW784172xrw00784
    • 2019-11-22
    129 min

    [ECB-124]No Way...You're Going To Squirt？ Maria Nagai

  • maria nagai censoredsluthandjobECBwaap entertainmentsamoaricobra warpECB-124ECB1242ecb00124
    • 2019-11-21
    215 min

    [NHDTB-342]A Horny Girl Who Was So Frightened That She Couldn't Turn Around As She Felt The Ass-Crack Monster Slowly Creeping Up Behind Her, That She Began Shaking Her Ass Back And Forth With Excitement 4 Sch**lgirls Only Special

  • censoredschoolgirlNHDTBnatural highjacken kodamaNHDTB-342NHDTB3421nhdtb00342
    • 2019-11-21
    60 min

    [SHN-023]Hotel Monster- The Bell Girl Is Too Ashamed To Even Resist When Her Beautiful Tits Get Fondled And She Gets Creampied

  • censoredcreampiesquirtingSHNnatural highitaka smith rimpounderspecially selected nachu girlsSHN-023SHN0231shn00023
    • 2019-11-21
    240 min

    [SVDVD-761]Shame! Naked Youth Strength Measurement 2019

  • censoredbeautiful girlSVDVDsadistic villageistSVDVD-761SVDVD7611svdvd00761
    • 2019-11-19
    57 min

    [SHYN-073]Sold As An Adult Video Without Permission! As Soon As She Joined The Company, This Voluptuous Assistant Director Turned Out To Actually Like Sex Because She's A Horny Little Bitch When We Shove Our Cocks Into Her Naturally Hairy Innocen

  • ayaka saeki censoredsingle workSHYNsod createakira saijosod female employeeSHYN-073SHYN0731shyn00073
    • 2019-11-18
    117 min

    [AVSA-112]Breaking In With A Chastity Belt After 30 Days Of Abstention, We Had Explosive Sex This Office Lady Was Made By Her Sadistic Pimp Boyfriend To Wear A Chastity Belt Reiko Kobayakawa

  • kobayakawa reiko censoredbig titsmature womanAVSAavs collector siceman ochiaiavscollector sAVSA-112AVSA112avsa00112
    • 2019-11-17
    119 min

    [JUL-042]The Magic Mirror Bus NTR Shocking Infidelity Videos Witnessing A Wife And A Boss Having Sex Saori Yagami

  • saori yagami censoredbig titsmature womanJULmadonnanagaeJUL-042JUL042jul00042
    • 2019-11-17
    145 min

    [JUL-050]A Shame Series Starts Up Again!! A Popular Actress With A Beautiful Face Is Back At The Madonna Label!! I'm Getting Fucked In Front Of My Dead Husband's Photo, And I'm Cumming So Hard I Think I'm Going To Lose My Mind. Arare

  • mochizuki hail censoredmature womansingle workJULmadonnatakeshi kogaJUL-050JUL050jul00050
    • 2019-11-15
    118 min

    [DDKM-005]Tied Up In Insane Orgy Sex Tied Up Consecutive Fucking With A Maso Bitch Mizuki Hayakawa

  • mizuki hayakawa censoredbdsmsingle workDDKMdogmaonimurayaDDKM-005DDKM005ddkm00005
    • 2019-11-15
    42 min

    [SHYN-067]Incredibly Massive Squirting! "The Legendary Floods Of The Squirting Princess" An SOD Female Staffer Tuber She Was Suddenly Fucked To Review Sex Toys She's In Her Third Year In The Finance Department Sayo Kunimitsu

  • yayoi kunimitsu censoredsquirtingsingle workSHYNsod createy 10432sod female employeeSHYN-067SHYN0671shyn00067
    • 2019-11-15
    164 min

    [WA-414]Married Woman Shame Dildo Lust Explosion Hard Masturbation

  • censoredmature womanWAlotusWA-414WA414h-047wa00414
    • 2019-11-15
    40 min

    [SHYN-066]I'm Really Embarrassed, But I Had An Orgasm "The Ecstatic Twist" An SOD Female Staffer Tuber She Was Suddenly Told To Review Sex Toys It's Her First Year In The Sales Department Satomi Otsuka

  • tomomi otsuka censoredbig titssingle workSHYNsod createy 10432sod female employeeSHYN-066SHYN0661shyn00066
    • 2019-11-15
    132 min

    [GNAB-008]A Married Woman Who Is Interested In Sex And Making Money Is Being Asked To Take A Walk With A Remote-Controlled Vibrator Up Her Pussy, And Now She's Bashfully Thrilling To The Shame Of It All...

  • censoredcreampieGNABprestigebang prestigeGNAB-008GNAB008118gnab00008
    • 2019-11-15
    180 min

    [DIPO-074]Secretly Filmed Videos Leaked!! Secret Adulterous Sex With Moms Who Live In The Same Apartment Building 5

  • censoredbig titsDIPOprimoero nandesuDIPO-074DIPO074h-283dipo00074
    • 2019-11-14
    223 min

    [ATOM-392]Shake Shake! Wobble Wobble! How Many Times Have You Been Groped？! If She Guesses Correctly She Wins A Prize! Titty Groping Pedometer Contest!

  • censoredbig titsATOMatomkari daigoinhhh groupATOM-392ATOM392atom00392
    • 2019-11-14
    193 min

    [OYC-288]Lunch Center Female Staff Sexual Harassment Health Exam

  • censoreduniformOYCoyashoku.companysleggerhhh groupOYC-288OYC288oyc00288
    • 2019-11-14
    237 min

    [ATOM-393]Slippery! Slip!？ Raw Insertion!？ A Pantyless Pussy Grind Human Rodeo

  • censoredATOMatomkari daigoinhhh groupATOM-393ATOM393atom00393
    • 2019-11-14
    118 min

    [OYC-289]We Went To A Coed Spa Resort And Targeted Girls Who Looked Like Pushovers For A Thrilling To-The-Limit Fondling Experience

  • censoredOYCoyashoku.companymatildahhh groupOYC-289OYC289oyc00289
    • 2019-11-14
    235 min

    [AP-715]Schoolgirl "Total Domain" Prank Body Measurement

  • censoredcreampieschoolgirlAPapachebarracudahhh groupAP-715AP715ap00715
    • 2019-11-09
    240 min

    [HJMO-418]Red Light, Green Light - With A Fixed Vibrator 15

  • censoredsquirtingHJMOhajime kikakuhajimeHJMO-418HJMO418hjmo00418
    • 2019-11-08
    176 min

    [EQ-487]Secret Pranks Underneath The Foot Warmer My Stepmom Is About My Age And Bursting With Lust Wicked Fakecest Creampie Raw Footage 5

  • censoredcreampiebig titsEQbullitthentai xshameEQ-487EQ487h-100eq00487
    • 2019-11-08
    118 min

    [UMD-709]She Musn't Dare Utter A Sound, But When She's Faced With This Rock Hard Cock, It Fills Her With Shame, But At The Same Time It Awakens All Of Her Repressed Lust, And Now This Horny Housewife Is Trying To Bite Her Tongue While Going C

  • roaring sound yurika censoredbig titsUMDleodragon nishikawaUMD-709UMD709125umd00709
    • 2019-11-08
    217 min

    [EQ-485]"Today, I'm Going To Go And Fuck Someone Else" Her First Married Woman Adultery Documentary Of Sincere Sex

  • censoredcreampiebig titsEQbritthirofumi katsuragibad workEQ-485EQ485h-100eq00485
    • 2019-11-07
    180 min

    [NHDTB-339]A Nipple Slurp-And-Suck Lesbian Assault This Sensual Girl Had Both Of Her Hands Tied Up And Asked To Cum

  • censoredbig titslesbianNHDTBnatural highmaki peyangNHDTB-339NHDTB3391nhdtb00339
    • 2019-11-07
    162 min

    [PIYO-050]A Bashful J* In Her First Serious Fuck "My Pussy Is Just Too Sensual, So Every Fuck Is A Life-Or-Death Situation..." The Most Amazing Sex She's Never Experienced Sex So Furious, And Now This Schoolgirl With Short Hair Is Cumming

  • censoredschoolgirlPIYOhyokopiero daPIYO-050PIYO0501piyo00050



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi