javcensored creampie jav pov slender




FC2ATIDCJODPPPDDASDSSNISDABLULURBDHUNTBHODVSSISMIDEPREDMILKFSDSSWAAAAVSAABWWANZNATR

2024-03-21
79 min

mmnm-007 Mio (22)

  • amateur censoredcreampiesquirtingmmnmmmnm-007mmnm007mmnm-007
    • 2024-03-19
    65 min

    791SHSK-010 Celebrity Purveyor Luxury Rental Girlfriend Tokyo Sister ⑥

  • amateur censoredcreampiemarried womanshskshsk-010shsk010791shsk-010
    • 2024-03-19
    103 min

    mfcs-107 Ah -chan (23)

  • amateur censoredcreampieamateurmfcsmfcs-107mfcs107mfcs-107
    • 2024-03-19
    75 min

    546EROFV-250 Amateur JD [Limited] Nana -chan 20 -year -old Model Class Is A Super -narrow Kawa JD!!A Long Black Hair THE Neat Young Lady Is Violently Panting And The Vaginal Cum Shot Is Complete

  • amateur censoredcreampieamateurerofverofv-250erofv250546erofv-250
    • 2024-03-18
    62 min

    INSTV-547 [Individual Shooting] Loripeta Beautiful Girl Kone -chan (24) A Painful Lovable Love Love With Him, Who Will Go Far Away Next Week, The Last Asakusa Dating Raw Fucking Creampie Video Leaked

  • censoredcreampiebeautiful girlINSTVhmn worksinstaINSTV-547INSTV547h-1472instv00547
    • 2024-03-16
    133 min

    TIKB-180 [Pakopako Douga] This Icharab Couple!It"s Too Erotic And It"s Impossible Www Nagisa Mitsuki

  • scooping censoredcreampiebeautiful girlTIKBchikikikikama delusion groupTIKB-180TIKB180tikb00180
    • 2024-03-15
    244 min

    MFCO-001 MOON FORCE WIFE Poco Kokushiro And A Married Woman Collection.vol.01

  • oikawa umi tsuzuki ruisa censoredcreampiebig titsMFCOdocmoon force okusamaMFCO-001MFCO001h-1711mfco00001
    • 2024-03-14
    93 min

    354KAMEF-073 Individual Specialization Cosmetic Photo Session Akari Nyan (21) BLACK KAMEKO FILE.73 Outside Store Connected Concafe Miss The First Raw SEX Experience For The First Time That You Can Not Tell To Anyone.

  • amateur censoredcreampieamateurkamefkamef-073kamef073354kamef-073
    • 2024-03-13
    73 min

    326MGK-002 Call The Uve Junior J ● Of Your Alma Mater With An OB Power → Bring It To Your Home And Get A Virgin And Creampie SEX!!

  • amateur censoredcreampiebig titsmgkmgk-002mgk002326mgk-002
    • 2024-03-13
    93 min

    mfc-284 Shin P (24)

  • amateur censoredcreampiesquirtingmfcmfc-284mfc284mfc-284
    • 2024-03-12
    59 min

    298HONB-363 Natural Barking GAL Is Launched In The Brored Vagina

  • amateur censoredcreampieamateurhonbhonb-363honb363298honb-363
    • 2024-03-12
    88 min

    326FCT-094 Slender Body And Gachi Beauty Big Breasts F -cup Back Dirt JD To Be Cosplayed In Uniforms And Creampie Gonzo

  • yuzu censoredcreampiebig titsfctfct-094fct094326fct-094
    • 2024-03-12
    104 min

    mfcs-106 Haruru (24)

  • amateur censoredcreampieamateurmfcsmfcs-106mfcs106mfcs-106
    • 2024-03-12
    58 min

    HONB-366 In The Mouth & Vagina 2 Launches In The 30kg Car Weak Girl Mina -chan

  • censoredcreampieHONBmercuryfirst shibuya special attack headquartersHONB-366HONB366h-1133honb00366
    • 2024-03-11
    89 min

    326FCT-088 [Kamimi Big Tits & Constriction] Dating With Real Estate Beauty OL Of Business Partners → SEX Gonzo At Home!!Slender But Volumey Beautiful Big Tits Body Is Too Erotic Www

  • kaho censoredcreampiebig titsfctfct-088fct088326fct-088
    • 2024-03-10
    62 min

    ddhp-050 Mi Ryo (20)

  • amateur censoredcreampieamateurddhpddhp-050ddhp050ddhp-050
    • 2024-03-03
    117 min

    300MIUM-1062 [Sister Who Is Just Standing Just Standing] Rental Of E -cup Insurance Business Outstanding Style As Her!Completely REC Of The Whole Story, Which Has Been Deducted And Spoiled To Erotic Acts That Are Originally Prohibited!!A Rich Raw Sex

  • amateur censoredcreampieamateurmiummium-1062mium1062300mium-1062
    • 2024-03-02
    129 min

    XVSR-746 Hentai Boyfriend And One Night 2 Day Shame Travel Asami Nagase

  • asami nagase censoredcreampiesingle workXVSRmax asono kancalenXVSR-746XVSR746xvsr00746
    • 2024-02-29
    101 min

    354KAMEF-071 Individual Photo -specific Idol Photo Session Hiyorin (25) BLACK KAMEKO FILE.71 Absolute Innocent Nationwide National Top Idol Tofu Cosplay Photo Session Erections Erection.Gonzo Without Rubber

  • amateur censoredcreampieamateurkamefkamef-071kamef071354kamef-071
    • 2024-02-29
    93 min

    328UINAV-003 [Sake Ran Bitch] S -class Chat Kubile JD JD Infinite Splash Fuck That The Real Intention And Tide Do Not Stop As You Drink [Bristle Yabe]

  • amateur censoredcreampiesquirtinguinavuinav-003uinav003328uinav-003
    • 2024-02-28
    81 min

    mfc-282 @Mion (21)

  • amateur censoredcreampieamateurmfcmfc-282mfc282mfc-282
    • 2024-02-26
    92 min

    mfcw-019 Yuna (26)

  • amateur censoredcreampieamateurmfcwmfcw-019mfcw019mfcw-019
    • 2024-02-23
    241 min

    MFCD-003 MOON FORCE Collection.vol.03

  • hobana airi nakagawa sora censoredcreampieamateurMFCDdocmoon force dreamMFCD-003MFCD003h-1711mfcd00003
    • 2024-02-22
    140 min

    769KANO-023 Amateur Furu Ichirab Creampie Vol.5 Also A & Rina

  • amateur censoredcreampieamateurkanokano-023kano023769kano-023
    • 2024-02-22
    120 min

    368SKJK-029 98cm Erotic Butt Gachiel Creampie Maya (21) Natsushira Maya

  • amateur censoredcreampieamateurskjkskjk-029skjk029368skjk-029
    • 2024-02-22
    93 min

    mmnm-005 Kana (28)

  • amateur censoredcreampieamateurmmnmmmnm-005mmnm005mmnm-005
    • 2024-02-22
    120 min

    368ICHK-029 This Is This!Bunny Kos Amateur Beauty Beauty Beauty Icharab Gachi Creampie Mai -chan & Lunlun Creampie Deledele Beauty Hisukawa Mai Matsumiya Hisui

  • maihoshikawa censoredcreampieamateurichkichk-029ichk029368ichk-029
    • 2024-02-22
    145 min

    KANO-024 Creampie Room Drink Icharab Natural G Cup Musaka Yui Arisaka

  • arisaka yui censoredcreampiebeautiful girlKANOmonthly girlfriendKANO-024KANO0241kano00024
    • 2024-02-21
    85 min

    mfc-281 Mio (22)

  • amateur censoredcreampiebig titsmfcmfc-281mfc281mfc-281
    • 2024-02-20
    80 min

    546EROFV-241 Amateur JD [Limited] Ria -chan 20 -year -old Bitch Girl Who Was Fired With Fans While Working As An Underground Idol!!A Large Amount Of No Weather Girls In The Color Of 0 Color Of The Reflection That Is Playing A Man As Soon As They Get

  • amateur censoredcreampieamateurerofverofv-241erofv241546erofv-241
    • 2024-02-18
    112 min

    300MIUM-1061 [Scandalous Huge Breasts] Rent A Tall F Cup Beauty Club Member As Your Girlfriend! A Complete Record Of The Entire Story Of How He Seduced Her And Even Performed Erotic Acts That Were Originally Prohibited! ! A BODY Unlike Any Japanese W

  • amateur censoredcreampiebig titsmiummium-1061mium1061300mium-1061
    • 2024-02-16
    42 min

    393OTIM-354 Vulgar Flattery, Flattery, Impregnation Plea, Child-making OK Service Maid AI

  • amateur censoredcreampieamateurotimotim-354otim354393otim-354
    • 2024-02-15
    92 min

    UINAV-002 [Bakki Baki Erotic Body] Mechashi Cosplay Slender Beautiful Breasts Muscle Training Girl Tipsy Muscle Protein Creampie On Cheat Day! ! [Chest Constriction Butt]

  • censoredcreampieUINAVhmn workshamedori.network secondeditionUINAV-002UINAV002h-1472uinav00002
    • 2024-02-15
    83 min

    KAMEF-069 Specializing In Individual Photography Big Breasted Idol Photo Session Ai-chan (19) Machida Lens"s BLACK KAMEKO FILE.69 An Idol Who Knows Nothing Participates In An Obscene Photo Session Like A Part-time Job. Her Breasts Are Photographe

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-069KAMEF069h-1350kamef00069
    • 2024-02-15
    84 min

    simm-873 Nana(18)

  • amateur censoredcreampieuniformsimmsimm-873simm873simm-873
    • 2024-02-15
    113 min

    HMRK-001 [Golden Ratio Erotic Body Healing Beauty] Although She Is Neat, She Likes Perverted Play! The Smile, The Blowjob Face, And The Orgasm Face Are All Cool! A Naughty And Beautiful College Girl With Beautiful Breasts And A Lovey-dovey Sex Video

  • miyanishi hikaru censoredcreampiebig titsHMRKdochameroku channelHMRK-001HMRK001h-1711hmrk00001
    • 2024-02-14
    82 min

    mfc-280 Yunachi (24)

  • amateur censoredcreampieamateurmfcmfc-280mfc280mfc-280
    • 2024-02-13
    95 min

    mfcw-018 Hikaru (32)

  • amateur censoredcreampiebig titsmfcwmfcw-018mfcw018mfcw-018
    • 2024-02-13
    87 min

    mfcs-103 Rikako (20)

  • amateur censoredcreampiesquirtingmfcsmfcs-103mfcs103mfcs-103
    • 2024-02-08
    89 min

    MMNM-004 A Banished Woman Whose Loneliness Is Taken Advantage Of By A Sex Man: Shi-chan (24) [A Sweet Swamp That Women Are Addicted To]

  • shichan censoredcreampieamateurmmnmmmnm-004mmnm004mmnm-004
    • 2024-02-08
    75 min

    KAMEF-068 Cosplay Photo Session Specializing In Individual Photography Sally (27) Machida Lens"s BLACK KAMEKO FILE.68 The Most Beautiful Office Lady Layer Is Creampied And Turned Into A Meat Urinal. She Is Raped With A Raw Dick And Her Plump Areo

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-068KAMEF068h-1350kamef00068
    • 2024-02-07
    81 min

    MFC-279 Developed Sensitive Portio X Shrimp Warped Slender Body [MoA(OL)] A Stimulating Sightseeing Date In Tokyo With A Local Girl In A Long-distance Relationship/Simultaneous Cum In Both The Stomach And Inside With Double Portio Torture/Ecstatic Co

  • amateur censoredcreampieamateurmfcmfc-279mfc279mfc-279
    • 2024-02-03
    120 min

    BAB-121 Continuous Creampie To Cute Yankee Slender Blonde Gal Club Pick-up SEIRA

  • censoredcreampieBABbabylon mousouBAB-121BAB121bab00121
    • 2024-02-02
    120 min

    NPJS-008 Isn"t Slacking Off At Work An AV？ It"s Work Time, But I Don"t Have Enough So I Have 3SEX. Tall And Slender Personal Gym Trainer (23)

  • censoredcreampiebeautiful girlNPJSnpjNPJS-008NPJS008npjs00008
    • 2024-02-01
    88 min

    KAMEF-067 Specializing In Individual Photography Big Breasts Cosplay Photo Session Ayako Machida Lens"s BLACK KAMEKO FILE.67 Real Hollywood Star And Returned Home Video Leaked Lewd Erotic Breasts Swaying And Trembling Ayako"s First Cosplay St

  • censoredcreampieamateurKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-067KAMEF067h-1350kamef00067
    • 2024-02-01
    84 min

    SIMM-871 [Yuzu-chan (18), A Slender J Who Shines In Sex♪♪A Pure Body With Only Her Boyfriend! Still Very Interested In H! Creampie To Healthy Slim-chan From The Soft Club♪】《J♪Erotic Record Of Girlfriend And Uncle Boyfriend》

  • yuzuchan censoredcreampieuniformsimmsimm-871simm871simm-871
    • 2024-01-29
    261 min

    MAZFX-007 007 [Many Masochists In The School: All Addicted To Dick] Slender Active Track And Field Team, Beautiful Breasts And Nice Butt Japanese Language Teacher, Instant Masochistic Young Lady, Piggyback And Pussy-haired Math Teacher, All Trained F

  • censoredcreampieMAZFXbeatleMAZFX-007MAZFX007h-1719mazfx00007
    • 2024-01-29
    101 min

    MFCW-017 [Creampie Sex With Zero Ethics Where Two People"s Sperm Mix Together! ] Immediately After Having Irresponsible Creampie Sex With An Unfaithful Man, An Outrageous Unfaithful Wife Has Sex With Her Husband, Who Knows Nothing About It, And H

  • nanase censoredcreampiebig titsmfcwmfcw-017mfcw017mfcw-017
    • 2024-01-29
    89 min

    476MLA-163 [Only Teenagers Can Win! ] Beautiful Big Breasts F Cup And Fair Skin Slender Super Divine Body! ! At School, I Creampied A Serious And Clean J

  • ahtan censoredcreampiebig titsmlamla-163mla163476mla-163
    • 2024-01-28
    108 min

    HMDNV-690 [Running Sexual Desire] A 24-year-old Slender And Happy Young Wife Brings Her Sex Friend With Her While Her Husband Is Away And Makes Her Do It! ! A Machine Gun Piston That Won"t Stop Even If You Cum Or Blow, It Will Break The Unconscio

  • censoredcreampiemature womanHMDNVhmn workshamedori.network secondeditionHMDNV-690HMDNV690h-1472hmdnv00690
    • 2024-01-27
    72 min

    GESY-029 [Standing] She Has A Cute Face And A Strong Sexual Desire X The Squirting Tide Sends Out An Alarm

  • iris censoredcreampieamateurgesygesy-029gesy029gesy-029
    • 2024-01-26
    242 min

    MFCD-002 MOON FORCE Pakopakoshiroto Collection. Vol.02

  • minase akari morishita kotono censoredcreampiebig titsMFCDdocmoon force dreamMFCD-002MFCD002h-1711mfcd00002
    • 2024-01-26
    26 min

    NJPD-010 Mitsuki Nagisa

  • scooping censoredcreampiebeautiful girlNJPDnew japan av actress directorynew japan av actress directoryNJPD-010NJPD010h-1754njpd00010
    • 2024-01-25
    66 min

    374IMGN-057 Rias-san

  • amateur censoredcreampieamateurimgnimgn-057imgn057374imgn-057
    • 2024-01-25
    144 min

    KANO-019 Amateur Sex Love Creampie VOL.4 Nagi & Mami

  • mamiya nagi nagisa mami censoredcreampiebeautiful girlKANOmonthly girlfriendKANO-019KANO0191kano00019
    • 2024-01-25
    140 min

    KANO-018 Amateur Sex Lovey-dovey Creampie VOL.3 Rei & Niina

  • misumi rei it s in tomikunaga censoredcreampiebeautiful girlKANOmonthly girlfriendKANO-018KANO0181kano00018



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi