javcensored high vision censored jav nampa




FC2NACRSQTEMARAROYDABWNATRNACXSSISSDABAUKGDASDWAAAAVSAHNDMIDEHMNPPPDFSDSSVENUIPX

2020-10-22
483 min

[FCDSS-004]Innocent Gravure Constriction E-cup Minami Ikuta BEST All 8 Titles, 8 Hour Special

  • ikuta minami censoredbeautiful girlsingle workFCDSSfalenoFCDSS-004FCDSS0041fcdss00004
    • 2020-10-30
    478 min

    [HRV-047]Real And Serious Seductions! A Super Selection!! A Beautiful Girl Special 34 Girls 8 Hours We Seduced Local Girls From All Across The Nation And Only Picked The Most Beautiful Girl Babes! 34 Beautiful Girl Babes! And All Of Them Get Fucked

  • censoredamateurHRVprestigeharvestHRV-047HRV047118hrv00047
    • 2020-11-01
    64 min

    324SRTD-0194 Bring a big tits shaved married woman with a hard guard to the room and the second round! AV actor Nampa Gonzo secret video

  • amateur censoredbig titsmarried womansrtdsrtd-0194srtd0194324srtd-0194
    • 2020-11-01
    446 min

    [HSF-010]POV Sex Friends vol. 10

  • censoredsquirtingslutHSFyou planningHSF-010HSF010189hsf00010
    • 2020-11-05
    68 min

    200GANA-2376 In the spear room of the Nampa teacher of 100 battles, bring in SEX hidden shooting 180 Bring the plump girls you met on SNS to your house! Glamorous body with big breasts and big butt! Moreover, the side dish repeat is confirmed by a se

  • amateur censoredbig titssquirtingganagana-2376gana2376200gana-2376
    • 2020-11-10
    56 min

    FC2PPV 1565328 [No / Amateur individual shooting] I had a very quiet personality, but … The sexual desire I had accumulated through my husband’s plain sex was ugly! An affair wife who suddenly changes and runs away! Creampie sex with a lewd

  • amateur uncensoredfc2
    • 2020-11-25
    73 min

    259LUXU-1347 Luxury TV 1331 An older sister of a beautiful beauty member who is fascinated by everyone appears on AV! A beautiful slender body with a thorough aesthetic sense greedily accepts pleasure and rolls up! Pay attention to her bold turbulenc

  • amateur censoredamateurluxuluxu-1347luxu1347259luxu-1347
    • 2020-11-26
    115 min

    [SPRD-1347]Dear Stepmom, I, I Like You Better Than My Wife... Mirei Fujisaki

  • misaki fujisaki censoredmature womansingle workSPRDtakara eizokyuta tukumoaleddinSPRD-1347SPRD134718sprd01347
    • 2020-11-28
    76 min

    300MAAN-604 [Puriketsu Bishoujo JD / Nurskos / Creampie & Facials] Maki from a rural area who is not familiar with Tokyo is lonely and masturbates 5 times a week! !! I’m shy, but in fact, it was my favorite Erokawa JD! !! In the reward of su

  • amateur censoredamateurcosplaymaanmaan-604maan604300maan-604
    • 2020-12-05
    57 min

    SIRO-4350 [First shot] [Favorability ○] [Active JD with glossy skin] A cute female college student who is obediently pleased when praised. It is a back part-time job that I applied with a light motive, but it feels too much .. AV application on the n

  • amateur censoredamateursirosiro-4350siro4350siro-4350
    • 2020-12-12
    63 min

    [HHKL-077]Hey Big Stepbrother, Let's Have Lots And Lots Of Sex Before Our Stepmom And Stepdad Cum Home! A Little Stepsister Who Wants To Get Fucked By Her Big Stepbrother, And A Big Stepbrother Who Wants To Fuck His Little Stepsister Their Steppa

  • mizuki yayoi censoredcreampiesisterHHKLhuntervolvo nakanohhh groupHHKL-077HHKL077hhkl00077
    • 2020-12-27
    239 min

    [DBVB-034]These She-Males Are Weeping Like Mad While Receiving Hot, Spasmic Love Highlights A Cross-Dressing Orgasmic Tale Of Ecstasy We'll Show You, From Start To Finish, How They Cum, Over And Over Again, And Even With Anal Pleasure

  • akitsu komachi mayuri censoredDBVBbabyentertainmentvenus babyDBVB-034DBVB034dbvb00034
    • 2021-01-09
    65 min

    SIRO-4345 [First shot] [Screaming baby-faced girl] [Powerful nice ass cowgirl] A pure female college student who still has the innocence of a girl. If you advance to the extent that the developing beauty man is about to break, the girl will panting w

  • amateur censoredamateursirosiro-4345siro4345siro-4345
    • 2021-01-16
    121 min

    [SSNI-973]Breaking In S********ls - Middle-Aged Guys With A School Uniform Fetish Nail A Teen Whether She Likes It Or Not... Sayaka Otoshiro

  • otoshiro sayaka censoreduniformbeautiful girlSSNIs1 no 1 stylekitorune kawaguchiSSNI-973SSNI973ssni00973
    • 2021-01-22
    240 min

    [MBM-264]A Deep And Rich Mature Woman!! She's Melting Like Hot Butter And You Can Hear Her Pussy Juice Squishing And Sloshing And Dripping Down Like Sweet Honey! Excessively Orgasmic Scream-Filled Sex With An Old Lady Who Loves To Fuck! A 20-Fuck

  • censoredamateurmature womanMBMprestigegaro sasazukambmMBM-264MBM264118mbm00264
    • 2021-01-23
    46 min

    450OSST-007 The sober girl I found in Korea was a wasteful beauty with hidden big breasts and a beautiful look hidden with glasses! The self-proclaimed C cup and the hidden big breasts that lie modestly are good to massage! It’s okay to shake!

  • amateur censoredbig titsamateurosstosst-007osst007450osst-007
    • 2021-01-24
    100 min

    [SRMC-028]Sensual Approach Of A Big Butted Wife Reiko Kobayakawa

  • kobayakawa reiko censoredslutsingle workSRMCh m rashmiyoshi rusherSRMC-028SRMC028srmc00028
    • 2021-01-29
    54 min

    [per-364]ほの 2

  • amateur censoredbig titssquirtingperper-364per364per-364
    • 2021-02-05
    241 min

    [HEZ-245]The Real Voices Of Married Woman Babes I Never Ever Thought About Committing Infidelity. But, When He Called Out To Me On The Street, I Found Myself Going Along With Him. 12 Ladies 4 Hours

  • censoredamateurHEZhot entertainmentHEZ-245HEZ24559hez00245
    • 2021-02-11
    135 min

    [SW-756]I Like Older Men. My Friend's Little Sister Was Totally My Type, And She Was The Kind Of Sch**lgirl Who Loved To Lure Men To Temptation! She Got Me Hot And Hard With Her Total Domain Of Knee-High Socks, And Tempted Me With Her Sweet Voice

  • kagami sara censoredschoolgirlsingle workSWswitchSW-756SW7561sw00756
    • 2021-02-12
    59 min

    [DHT-246]Please Introduce Me To Someone Hornier Than You! 4 A Horny Bitch's Friend Has To Be A Horny Slut Too! Anyone Can Agree, These Girls Are The Sure Thing, Guaranteed To Be A Great Fuck, No Matter How Many Times They Fuck, So Here We Are, Fu

  • censoredbig titssquirtingDHThot entertainmentyen ikkiDHT-246DHT24659dht00246
    • 2021-02-13
    67 min

    SIRO-4427 [First shot] [Sakamichi series beautiful girl] [Glossy little devil service] A perfect professional student who has an idol-class beauty face and a model-like style. In addition, she has the highest sensitivity, and when it is pierced viole

  • amateur censoredamateurbeautiful girlsirosiro-4427siro4427siro-4427
    • 2021-02-19
    223 min

    [SIM-109]My Super Young Stepmom Is A Total Slut - She's Down To Fuck Her Stepson Any Time He Wants

  • censoredcreampieSIMprestigeamateur pussiesSIM-109SIM109118sim00109
    • 2021-02-20
    86 min

    [VNDS-3359]Step Nephew Gets Turned On Looking At His Step Aunt's Huge Ass And Panties While She Changes Her Clothes

  • kyoka kahara anka kahara rumi kodama censoredbig titsblowjobVNDSstar paradisenext11VNDS-3359VNDS3359h-254vnds03359
    • 2021-03-04
    67 min

    [SIROR-052]The Work Of A Mature Woman For Rent - The Secret Side Of A Wife That Her Husband Will Never See - FILE NO.52

  • censoredcreampiebig titsSIRORdispatched.comSIROR-052SIROR052h-1492siror00052
    • 2021-03-16
    47 min

    FC2PPV 1728986 [No] [Limited to 100 pieces 2980 → 1480pt OFF!] Stress release with decachin! F cup woman working at a high-class Japanese restaurant ♥ ️ Massive vaginal cum shot! !! ♥ ️ ※ Review privilege / Ufufu masturbation with Denma ♥

  • amateur uncensoredfc2
    • 2021-03-22
    102 min

    241GAREA-500 Airu

  • amateur censoredamateurnursegareagarea-500garea500241garea-500
    • 2021-03-25
    131 min

    [MOND-212]With My Female Supervisor Crush Akari Niimura

  • akari shinmura censoredsingle workMONDtakara eizohotate ikkandaiichi housouMOND-212MOND21218mond00212
    • 2021-03-26
    45 min

    [scute-1102]みるか(20)

  • amateur censoreduniformamateurscutescute-1102scute1102scute-1102
    • 2021-04-08
    88 min

    [KDS-002]【配信専用】キュンde旬 VOL.2 ちなつ20歳 着物でしっぽり川越小江戸デート！あれこれ食べ歩きした後は旅館でずっぽし！！

  • amateur censoredamateurbeautiful girlkdskds-002kds002kds-002
    • 2021-04-14
    119 min

    [TPPN-189]Her First Orgasmic Ecstasy! Enter: The Mysterious Beautiful Girl And Her First Experience With The Ultimate Pleasure...

  • censoredblowjobbeautiful girlTPPNteppanTPPN-189TPPN189tppn00189
    • 2021-04-18
    91 min

    300NTK-531 Indecent G Breasts Demon Kubire’s Finest Beautiful Wife Leaves Insertion In The Second Half Of The Gangbang! !! Two lewd married women x two other sticks, and the degree of ethics is 200 times! !! De Nasty Nature That Can’t Be Sh

  • amateur censoredcreampiebig titsntkntk-531ntk531300ntk-531
    • 2021-04-24
    176 min

    FC2PPV 1784458 Reina-chan Creampie 8 Barrage! 3Q Toreina-chan’s lovely documentary ☆ [Personal shooting]

  • amateur uncensoredfc2
    • 2021-05-01
    230 min

    [HUNTB-003]"Starting Today, My Titties Belong To You! Both Of Them ..." My Little Stepsister's Tits Belong To Me Now, And They're Still Growing! I Get To Lick Them, Suck Them, And Nibble On Them And Fondle Them However I Want!

  • apricot ogura censoredbig titssisterHUNTBhuntermorikihhh groupHUNTB-003HUNTB003huntb00003
    • 2021-05-18
    30 min

    FC2PPV 1823399 Limited time offer [Individual shooting] Prefectural general course ③ Staying with a stranger uncle who wants to sleep with money. Girl who is vaginal cum shot without permission

  • amateur uncensoredfc2
    • 2021-05-28
    129 min

    [WZEN-046]I Found A Slutty Girl Who Loves Older Men ~ Massage Parlor Worker Miki-chan ~

  • censoredamateurblowjobWZENwaap entertainmentWZEN-046WZEN0462wzen00046
    • 2021-06-10
    64 min

    515BTGL-007 Hina (22)

  • amateur censoredanalcreampiebtglbtgl-007btgl007515btgl-007
    • 2021-06-11
    116 min

    [KAM-084]I Filmed Myself Fucking My Brother's Wife And Posted It As POV

  • censoredcreampiebig titsKAMkarmamanji groupKAM-084KAM084kam00084
    • 2021-08-19
    72 min

    [AKDL-133]KDK [Kudoki] I Convinced This Woman. Real Estate Saleswoman, 23 Years Old - Rua Takashiki

  • takashiki censoredbig titsAKDLaquinoriaquinoriaknrAKDL-133AKDL1331akdl00133
    • 2021-08-31
    43 min

    292MY-482 Yoneyama Yuna 2

  • amateur censoredbig titsmarried womanmymy-482my482292my-482
    • 2021-09-24
    222 min

    [HUNTB-103]My Perverted Distant Cousin Loves Sucking Me Off And Won"t Let Go When She"s Between My Legs! It"s The First Time Meeting Her In Many Years After Growing Up. She Still Looks Innocent

  • censoredcreampieschoolgirlHUNTBhunterkonnyaku kannohhh groupHUNTB-103HUNTB103huntb00103
    • 2021-09-28
    49 min

    [ETQR-289][Delusional Subjectivity] You Can Do Whatever You Want To This Body Tsugumi G-cup

  • censoredcreampiebig titsETQRerotic timeETQR-289ETQR289etqr00289
    • 2021-10-01
    133 min

    [NACR-470]This Beautiful Girl Is Hunting For Sugar Daddies And Loves To Tweak Nipples And Lick Bodies Up And Down With Slobbering Foreplay!! Noa Miura

  • miura noai censoredcreampiebig titsNACRplanet plushimurokkushichi ku ryuuNACR-470NACR470h-237nacr00470
    • 2021-10-20
    140 min

    [VNDS-3378]A Beautiful Married Woman Bashfully Participates In A Masturbation Watch Party

  • ichinose ayame akizono koe censoredblowjobmature womanVNDSstar paradisenext11VNDS-3378VNDS3378h-254vnds03378
    • 2021-11-18
    487 min

    [ABBA-542]Mature Girls With Big Tits - Made To Take Womb Bukkake 30 MILFs 8 Hours 2 Discs

  • censoredcreampiebig titsABBAcenter villageABBA-542ABBA542h-086abba00542
    • 2021-11-21
    60 min

    [112121-001]SEX while exchanging saliva!

  • erika shiomi uncensoredcreampiehandjobcaribbeancom
    • 2021-12-10
    120 min

    [IPX-784]My Father-in-law Hates Me To Death, But His Favorite Food Is Me As A S********l... Minami Aizawa

  • minami aizawa censoredschoolgirlsingle workIPXidea pocketinaballdishIPX-784IPX784ipx00784
    • 2021-12-10
    137 min

    [ROE-028]My Mother Is Getting Remarried... I"m So Jealous I Can"t Stop Myself From Fucking

  • good miki ryoko izawa miki yoshii censoredcreampiemature womanROEmadonnaunicorn fukudamonroeROE-028ROE028roe00028
    • 2021-12-14
    58 min

    [HEYZO-2678]Akemi Kihara New Soapland Whore"s Quick Suck And Creampie!

  • akemi kihara uncensoredcreampieheyzo
    • 2021-12-16
    63 min

    336KNB-185 [This Is Real Married Woman Boobs! ] Good-Looking Wife Saddle Only Www Personality Is Good ● Po Lover, There Is No Loss To A Married Woman With A Fluffy Body Wwww At Kemigawa Station Square, Hanamigawa-Ku, Chiba City, Chiba Prefecture (Nan

  • amateur censoredbig titsmarried womanknbknb-185knb185336knb-185
    • 2021-12-18
    57 min

    [HEYZO-2675]Nana Kamiyama After 6 -Irresistible Lust-

  • nana kamiyama uncensoredcreampieheyzo
    • 2021-12-24
    52 min

    [WKD-049]Fallen Woman - Himari Kinoshita

  • himari kinoshita himari hanazawa censoredslutsingle workWKDwaap entertainmentk westwWKD-049WKD0492wkd00049
    • 2022-01-05
    79 min

    259LUXU-1526 Luxury TV 1505 A Beautiful Woman With The Tech That Makes A Veteran Actor Look Like She’s Going To Live For The First Time! Dense Sexual Intercourse Of A Slender Slut Who Applied To Blame The Actor! !! (Aya Izumi)

  • amateur censoredbig titsamateurluxuluxu-1526luxu1526259luxu-1526
    • 2022-01-21
    124 min

    [BOBB-332]Colossal H-Cups! Boin "Io Hayami" Boxed Set: Her Rare Puffy Nipples Get Pinched, Licked, Sucked, And Shaken Up In This Definitive Breast Fetish Playbook Special!!

  • hayami yorizakura censoredbig titsblowjobBOBBabc mousouzokuboinbb abcBOBB-332BOBB332bobb00332
    • 2022-01-26
    42 min

    FC2PPV 2623540 Mizuna-San (23), An Apparel Clerk Of Her Sister. She Gets Squid With A Blow Job That Attacks Huge Breasts Fucking → Cheek Shot.

  • amateur uncensoredfc2
    • 2022-01-30
    241 min

    [RD-1099]A Lewd Mature Woman"s Lust. 7 Performers, 4-Hour Special. Wives Get Worked Up Without Their Husbands Knowing.

  • amateur censoredblowjobmature womanRDatena eizouRD-1099RD1099



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi