javcensored jav creampie amateur big butt




FC2DTTNACXAVSANNPJAUKGSPRDCHRVVENXPREDSQTEMIAAHDKAVEMAMIDVHMNWAAAABWPPPDCESDNACR

2020-09-11
240 min

[AMA-064]A Sexual Genius A Shocking Horny Amateur Test Shoot These Real Amateur Babes Are Here Test The Limits Of Their Sexual Talents For The PRESTIGE Label vol. 64

  • censoredbig titssquirtingAMAprestigeamateurAMA-064AMA064118ama00064
    • 2020-09-14
    42 min

    [orec-588]せな

  • amateur censoredcreampieamateurorecorec-588orec588orec-588
    • 2020-09-15
    51 min

    285ENDX-305 Misaki-san, 21 years old A tutor is not the place to study G cup [Amateur]

  • amateur censoredbig titsamateurendxendx-305endx305285endx-305
    • 2020-09-24
    162 min

    [NHDTB-439]A Perverted Private Tutor Who Breaks In The Ass Of Any Of His S*****ts Who Get A Bad Mark On The Test

  • censoreduniformNHDTBnatural highremonha to nakashimaNHDTB-439NHDTB4391nhdtb00439
    • 2020-09-26
    125 min

    [WANZ-989]My Busty Married Coworker Let Me Stay At Her Place When I Missed The Last Train Home... She Lounges Around Without A Bra And I Couldn't Resist The Way She Jiggled - We Wound Up Fucking All Night Long! JULIA

  • julia censoredcreampiebig titsWANZwanz factorywanzWANZ-989WANZ989wanz00989
    • 2020-10-17
    119 min

    [SSNI-895]Relaxed Older Step-Sister Doesn't Wear Panties In Summer! Defenseless Temptation Amin Nina

  • new name amin censoredbeautiful girlsingle workSSNIs1 no 1 stylebungo maedaSSNI-895SSNI895ssni00895
    • 2020-11-06
    163 min

    [HUNTA-885]"What!？ Are They Kissing!？" "Aren't They Fondling Their Tits？" I Was Watching Two Girls Getting Hot And Horny With Each Other, And Then They Started Cumming For My Cock! "It's Great To Be Alive!" A Miracu

  • censoredcreampieHUNTAhuntercognac kaminohhh groupHUNTA-885HUNTA885hunta00885
    • 2020-11-09
    51 min

    444KING-017 Rikasan

  • amateur censoredcreampiebig titskingking-017king017444king-017
    • 2020-11-18
    65 min

    FC2PPV 1574890 [Personal shooting / set sale] 30-year-old busty wife who was forcibly brought in full version

  • amateur uncensoredfc2
    • 2020-11-26
    154 min

    [SVDVD-828]Yoga Babes Take On The Orgasm Machine! It's Been So Long Since They've Felt This Level Of Ecstasy And They Cum So Hard They Squirt! Their Pussies Are So Wet, Horny And Throbbing They Can't Resist A Creampie!

  • censoredcreampiesquirtingSVDVDsadistic villagejiro tsubuyakiSVDVD-828SVDVD8281svdvd00828
    • 2020-11-29
    79 min

    [srho-037]こまり(20)

  • amateur censoredcreampieamateursrhosrho-037srho037srho-037
    • 2020-12-01
    241 min

    [EMOIS-014]She's Insecure About Her Height - This Tall Girl Only Had Sex Twice - Mugi Honjo's (20) Porn Debut

  • barley censoredamateursingle workEMOISsod createemotional girlEMOIS-014EMOIS0141emois00014
    • 2020-12-11
    27 min

    FC2PPV 1601853 No-hand blow job in suit x black pantyhose ♥ Finally, semen is injected into the pussy! [Review benefits available]

  • amateur uncensoredfc2
    • 2020-12-11
    80 min

    300NTK-461 Erotic 7th generation! !! Beauty G milk 170cm beauty layer P activity! !! It looks like a neat and clean older sister model, but … Gala negotiations are tight! !! Raw insertion is priceless ww / daddy activity defeat / fifteenth perso

  • amateur censoredcreampiebig titsntkntk-461ntk461300ntk-461
    • 2020-12-12
    27 min

    FC2PPV 1603615 [No] Massive vaginal cum shot from a blowjob to a blonde beauty who wants

  • amateur uncensoredfc2
    • 2020-12-20
    119 min

    [HND-933]Creampie Soapland Brothel That'll Let You Fuck Them Bareback Every Time Haru Kawamura

  • kawamura haru censoredcreampiebig titsHNDhon nakazaku araiHND-933HND933hnd00933
    • 2021-01-06
    122 min

    [GVH-172]Titty-Loving Naughty Boy Plays Pranks Nanao Nakano

  • nanao nakano censoredbig titssingle workGVHglory questtorindoru tanakaGVH-172GVH17213gvh00172
    • 2021-01-09
    31 min

    279UTSU-487 Sakino

  • amateur censoredcreampiebig titsutsuutsu-487utsu487279utsu-487
    • 2021-01-15
    218 min

    [BAZX-267]POV Sex With A Beautiful Girl In Sailor Uniform vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-267BAZX267h-1496bazx00267
    • 2021-01-15
    45 min

    FC2PPV 1644887 Operator

  • amateur uncensoredfc2
    • 2021-01-16
    41 min

    FC2PPV 1647689 [Personal shooting] 18-year-old neat and clean beautiful girl ⑤. She has a swimsuit, lotion and cheating vaginal cum shot. “Creampie and fast … ♡” Raw vaginal seeding and vaginal cum shot

  • amateur uncensoredfc2
    • 2021-01-24
    127 min

    [GENM-070]The Sequel: Breaking In A Trapped Babe At An Outdoor Warehouse Caught On Camera Rika Tsubaki

  • tsubaki rika censoredbig titssingle workGENMgenekig 3GENM-070GENM070genm00070
    • 2021-02-07
    240 min

    [MLSM-038]Smoking Hot MILF BEST Collection Mio Kimijima 4 Hours, Slender Mature Babe With Big Tits

  • kimishima mio censoredcreampiebig titsMLSMmellow moonMLSM-038MLSM038mlsm00038
    • 2021-02-11
    61 min

    Pacopacomama 021121_433 Kana Miura

  • amateur uncensoredpacopacomama
    • 2021-02-27
    62 min

    1Pondo 022721_001 Train Ryu Enami in a kimono vulgarly! Ryu Enami

  • amateur uncensored1pondo
    • 2021-03-05
    87 min

    [ZOZO-056]The New Female Teacher: Saya Sakura Tsukishima's Shame! Sexual Education At An All-boys' School

  • censoredcreampiebig titsZOZOsadie willenauZOZO-056ZOZO0561zozo00056
    • 2021-03-06
    102 min

    [SHKD-931]This Housewife Who Was Unfaithful While Trying For A Baby With Her Husband... What Does She Actually Hope For When She Does Become Pregnant？ Yuri Sasahara

  • yuri sasahara censoredcreampiesingle workSHKDattackersmitsukisharkSHKD-931SHKD931shkd00931
    • 2021-03-12
    67 min

    [DPL-001]Number One Marathon Runner At The Prefectural Competition In Middle School ~ Fucking An Athletic Beauty With Toned Muscles ~ Saki Konno 22 Years Old

  • konno saki censoredcreampiesingle workDPLcaprangerDPL-001DPL001h-1557dpl00001
    • 2021-03-26
    170 min

    [MIAA-411]Daddy's Girl Big Titty Girls Who Want Pocket Change Go To The Love Hotel After School Ruka Inaba Yukino Nagisa

  • inaba yukino nagi censoredcreampiebig titsMIAAmoody strendy yamaguchieveryone s kikatanMIAA-411MIAA411miaa00411
    • 2021-04-01
    47 min

    H4610 ki210401 Yumika Maijima 25years old

  • amateur uncensoredh4610
    • 2021-04-01
    299 min

    [PAR-2102]Secret Footage 5 Hours 6 Couples Having Adulterous Sex At Love Hotels 26 Married Women Taking Showers Secret Peeping

  • censoredmarried womanPARtm createyataro nozomipapayaPAR-2102PAR2102165par02102
    • 2021-04-09
    64 min

    FC2PPV 1761988 [Miracle Sister Donburi 2] Sister 18 years old K ③, Sister 28 years old OL Pitch Pichi Geki Ubu K ③ Sister Sister SEX and estrus! A demon big cock is thrust into a shaved pussy and she faints in agony Acme → Seeding falls. The stronges

  • amateur uncensoredfc2
    • 2021-04-13
    207 min

    [SDTH-004]She's Ready To Get Creampie Fucked An F-Cup Titty Uncool But Cute Slut From Hiroshima She's A Horny Slutty Amateur Who Loves Sex More Than Money And That's Why She Came Here To Film This Adult Video Straight From The Downtown Ar

  • nao ozaki censoredcreampiebig titsSDTHsod createafro takahashieromanceSDTH-004SDTH0041sdth00004
    • 2021-05-07
    150 min

    [MEYD-677]A Son's Wife Just Can't Resist Her Father-In-Law's Seduction - She Acts Like She Doesn't Want It, But She Keeps Cumming For More Yu Shinoda

  • shinoda yu censoredcreampiesingle workMEYDtameike goroMEYD-677MEYD677meyd00677
    • 2021-05-08
    130 min

    [CEMD-005]Squirting Is How Lesbians Show Their Love. Girl On Girl Gushing: Mihina Hina Kanno

  • mihina azumihina mihina nagai jinno hina censoredsquirtinglesbianCEMDceleb no tomoCEMD-005CEMD005cemd00005
    • 2021-05-13
    250 min

    [ABW-090]ひたすら生でハメまくる、終らない中出し性交。 体内射精21連発 蜜美杏 【MGSだけのおまけ映像付き 20分】

  • amateur censoredcreampiebig titsabwabw-090abw090abw-090
    • 2021-06-04
    59 min

    230OREC-786 Y-chan

  • amateur censoredcreampieuniformorecorec-786orec786230orec-786
    • 2021-06-19
    146 min

    [CAWD-242]Tempting Knee High x Total Domain: HinanoTachibana

  • hinano tachibana censoredsingle workCAWDkawaiitake dCAWD-242CAWD242cawd00242
    • 2021-06-23
    55 min

    FC2PPV 1884077 ★ First shot amateur ☆ Bombshell huge breasts dynamite body ♥ Devil’s mature wife aiming for another stick ♥ Tomoko 36 years old ☆ Exciting vacuum blowjob ♥ Unstoppable libido ♥ Continuous Iki’s intense squirrel is a great wo

  • amateur uncensoredfc2
    • 2021-06-25
    102 min

    [YSN-551]My Father-In-Law's A Stud And I'm A Nympho: We Bang Around The Clock Yuri Honma

  • really censoredcreampiebig titsYSNnonYSN-551YSN551h-127ysn00551
    • 2021-07-02
    120 min

    [JUL-643]I Wanted To Test My Wife's Love For Me, So I Left Her Alone With My Horny Co-Worker, And 3 Hours Later ... He Kept His Dick Inside Her The Entire Time For 16 Creampie Cum Shots, And Took Her Away From Me In This Woeful NTR Tale Reiko Kob

  • kobayakawa reiko censoredcreampiebig titsJULmadonnarokusaburo mishimaJUL-643JUL643jul00643
    • 2021-07-12
    61 min

    SIRO-4575 [First shot] [Smooth JD with a naive face] [Fair-skinned slender] It looks like an adult, but I’m thinking about naughty things. If you get used to the tight female college student’s tightness with a big cock .. Application amateu

  • amateur censoredamateursirosiro-4575siro4575siro-4575
    • 2021-07-15
    131 min

    [TIKB-116]My Super Cute Friend With Benefits Hana-tan, Starring Hana Shirato

  • white peach censoredcreampiebeautiful girlTIKBtikitiki.comerTIKB-116TIKB116tikb00116
    • 2021-07-24
    87 min

    300MAAN-678 [Over 500 Cuteness! !! Beautiful Legs X Knee Socks Sex] Overwhelmingly Transparent And Overwhelming Beautiful Girl Helps Her Graduate From Virginity At The Request Of Her Boyfriend! !! Suction Blow & Best Fucking From S Plenty Of Word

  • amateur censoredcreampieamateurmaanmaan-678maan678300maan-678
    • 2021-08-07
    242 min

    [XRL-018]Four Hours Of Just Doing As You Please With A Barely Legal In A Secret Room

  • kanon kanon kagami sara censoredcreampiebeautiful girlXRLk m producereal real worksXRL-018XRL018xrl00018
    • 2021-08-21
    147 min

    [DBER-121]Female Body Shame Institute III JUDAS FINAL STAGE Story-6 A Y********l Crying Hard At The Climax Of Shame - Natsu Tojo

  • natsu tojo censoredbdsmsingle workDBERbaby entertainmentkikubonred babeDBER-121DBER121dber00121
    • 2021-08-31
    120 min

    [SAN-016]Best Cuckold! I"ll Have That Body Again During The Three Days He"s Gone! Rina Takase

  • rina takase censoredcreampiebig titsSANmazakisakura kabinmother mazaSAN-016SAN016h-796san00016
    • 2021-09-04
    130 min

    390JAC-109 [Super Sex Brain X Big Breasts G Cup X Squeezing Cowgirl] “I Can’T Be Satisfied With Just 3 Minutes!” Libido Explodes In Too Short Sex! Squeeze 7 Pos At The Woman On Top Posture! Iki Tide & Climax Peeing All Over The Roo

  • amateur censoredcreampiebig titsjacjac-109jac109390jac-109
    • 2021-09-08
    80 min

    259LUXU-1475 Luxury TV 1454 Introducing A Beautiful Esthetician With Transparency, Healing And Unique Magic! She Has A Bewitching Expression When She Sees A Big Cock Erected By Her Proud Esthetic Technique. A Must-See For Her Beautiful Slender Style

  • amateur censoredamateurluxuluxu-1475luxu1475259luxu-1475
    • 2021-09-11
    43 min

    362SCOH-061 [Creampie] Let A Carefully Selected Beautiful Girl Cosplay And Conceive My Child! [Le ● Rin 3] Mirei Nitta

  • amateur censoredamateurcosplayscohscoh-061scoh061362scoh-061
    • 2021-09-23
    131 min

    [SPRD-1464]Horny Father In Law. What Happens When An Earnest Wife Keeps Getting Fucked By Her Father In Law... Karen Mifune

  • karen mifune censoredmature womansingle workSPRDtakara eizouohare konaleddinSPRD-1464SPRD146418sprd01464
    • 2021-09-25
    131 min

    [HMGL-188]Shy Bodies, Black Sun Yumi Saeki

  • yuka saeki censoredmature womandeepthroatHMGLhmjmcompany matsmaglamourHMGL-188HMGL188h-172hmgl00188
    • 2021-09-28
    64 min

    SIRO-4642 [First Shot] [Beautiful Big Tits] [Adult Atmosphere] Discover A Beautiful And Moody Shy Girl With A Wonderful G Cup. The Beautiful Naked Body With Excessive Libido Who Indulges In Masturbation Every Day Is Accompanied By Fire With Expectati

  • amateur censoredbig titsamateursirosiro-4642siro4642siro-4642
    • 2021-10-08
    139 min

    [YMDS-052]Partying At Home Instead Of Going Out, Leading To Passionate, Deeply Intimate French Kissing And Sex. The Day Iroha Minami Became My Girlfriend.

  • minami iroha censoredcreampieblowjobYMDSmomotarou eizou shuppanishikiribashi hakasejaku momoYMDS-052YMDS052ymds00052
    • 2021-10-16
    120 min

    [AQSH-077]My Junior Colleague"s Beautiful Wife A Man That Knows Her Escort Past Was Her Husband"s Senior Colleague... Rei Kuruki

  • satoshi kuruki censoredcreampiemature womanAQSHaqua mall heroaqua mallAQSH-077AQSH077aqsh00077
    • 2021-10-22
    39 min

    FC2PPV 2364568 [Personal Shooting, Orgy, Vaginal Cum Shot, 500p Off For A Limited Time] A Delicate Wife Who Keeps Aching And Prioritizes The Insertion Of Other Sticks Over The House.

  • amateur uncensoredfc2



    • Jav kiwi, watch JAV uncensored Free as happy as eating kiwi